KEGG   Bacillus cereus G9842: BCG9842_B0603Help
Entry
BCG9842_B0603     CDS       T00815                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00071  Fatty acid degradation
bcg00362  Benzoate degradation
bcg01100  Metabolic pathways
bcg01120  Microbial metabolism in diverse environments
bcg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BCG9842_B0603
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG9842_B0603
Enzymes [BR:bcg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCG9842_B0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACK94935
UniProt: B7IJ22
Position
complement(4455918..4456694)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGL
FSEESLLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQRESQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggcgacgttaaatcat
gcaccagcaaatgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggaaaaggatgataacattcgtgttgttgttattcacggtgaaggacgtttcttctca
gcaggagcagatattaaagaatttacatctgttactgaagcgaagcaagcaacagaatta
gcacagcttggacaagttacgtttgagcgtgttgaaaaatgttcaaaaccagttattgcg
gcaattcatggagcggcactgggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagtgcaaaacttggtttacctgaattaacacttggattaattcctggc
tttgcaggtacacagcgcttaccacgttatgttgggaaagcaaaagcttgtgaaatgatg
ttaacaagtacaccaattactggtgcagaagcattgaaatggggacttgttaacggattg
ttctctgaagaatcacttttagatgatacgcttaaagtcgcaaaacaaattgctggaaaa
agtccagcaacaactcgtgctgtactagagttattgcaaacgaccaaatcgtctcattac
tatgaaggtgtacaacgtgaatcacaaatttttggtgaagtatttacgagtgaagatgga
agagaaggtgtagctgcatttttagaaaagcgtaaaccttcatttagtggcaggtag

DBGET integrated database retrieval system