KEGG   Bacillus cereus G9842: BCG9842_B2510Help
Entry
BCG9842_B2510     CDS       T00815                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00010  Glycolysis / Gluconeogenesis
bcg00020  Citrate cycle (TCA cycle)
bcg00620  Pyruvate metabolism
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
bcg01130  Biosynthesis of antibiotics
bcg01200  Carbon metabolism
Module
bcg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B2510 (acoC)
   00020 Citrate cycle (TCA cycle)
    BCG9842_B2510 (acoC)
   00620 Pyruvate metabolism
    BCG9842_B2510 (acoC)
Enzymes [BR:bcg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BCG9842_B2510 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ACK93249
UniProt: B7IJJ5
Position
complement(2676371..2677570)
Genome map
AA seq 399 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKPNEKVEMKESTPVIEEKTSNIEAQHVQHPEPYVKEVAKQRIK
ISPVAKKIAKSENLDIKALVGTGPGGRITKADVLKALEVRGNVPEISEREESNAVPVTGM
RKAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVVL
ALGEHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLVVSAIRFANNLSLVELSKEIKNVAQ
KARAGSLSSDDMHGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGEKLRK
GSMLPLSLTFDHRVLDGAPAAAFLRTIKHYLEEPITILL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttaggtatggcgatgaaagaaggtattattacg
agctggaatattaaagcaggcgataatgtagcaaaaggagaactgatcgctagtattaac
tcagaaaaaattgaaacggaaattgaagcacccgctgatggtacggtacttgatatagct
gtaagtgaagatgaaggagtgccgcctggtactgtaatttgctacatcggtaaaccgaat
gaaaaagtagagatgaaggaaagtacacctgttatagaagaaaaaacatctaatatagaa
gcgcaacatgtacaacatccagaaccttatgtgaaagaagtggcgaagcaacgaatcaaa
atttcacctgtagcgaagaaaattgcaaagtctgaaaatctggatatcaaggcattagtt
ggcacaggtcctggcggaaggattacaaaggcagatgtattaaaagcacttgaggtaaga
ggaaacgttccggaaatatctgaacgagaagaaagtaacgcggttcctgttactggtatg
cgtaaagcaatcgcaaatcgtatgcacgcaagcttacaaaatagcgcacaattaacgtta
acgatgaaagtagatgtaacagatttagttgctttacataaagaaatagcagaagttgta
caaaaaagatatgataacaaactaaccattacggatttcgtctctcgtgctgttgtatta
gcgcttggggagcataaagaaatgaacagcgcttatatagatgatgcaattcatcaattt
gaacatgttcatttaggcatggcagtcgcattagaaaaagggttagtcgtttcggctatt
cgctttgcaaataatttatctttagtagagttgtctaaagagattaagaatgtggcacaa
aaggcacgagcaggtagcttaagtagtgatgatatgcacggaacgacatttacaattagt
aatttaggtagctttggtattgaatattttacgccggtattaaatacacctgaaactggt
attttaggtgtaggtgcaattgaacatgttcctgtatataaaggggaaaaactaagaaaa
ggaagtatgttacctttaagtttaacattcgatcatcgtgtattagacggtgcaccagca
gctgcatttttacgcacaattaaacattatttagaagaacctataacaattcttttataa

DBGET integrated database retrieval system