KEGG   Bacillus cereus G9842: BCG9842_B2765Help
Entry
BCG9842_B2765     CDS       T00815                                 

Definition
oxidoreductase, zinc-binding dehydrogenase family superfamily
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcg  Bacillus cereus G9842
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCG9842_B2765
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B2765
  Lipid metabolism
   00071 Fatty acid degradation
    BCG9842_B2765
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCG9842_B2765
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCG9842_B2765
   00626 Naphthalene degradation
    BCG9842_B2765
Enzymes [BR:bcg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCG9842_B2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2443674..2444315
Genome map
AA seq 213 aa AA seqDB search
MEQYKLVLEGAKQLKWEPGKIRSIQDDEIIVKTIAGAISIGAELPQYNGSDVTDTNPFYP
RKTGYESYGEVIEVGNKVTHVNVGDKVVFFYGHETIGIVKGHKVIRVPSSIQPKVALLSI
LSCDAAKGVLKLNPQQDEKVLITGMGVIGLLACYFLKYYVGVEHVDVVEPNKNRRDFAKN
FGAKNIYDSEEKIIETYNYGFECSATNSGFHAF
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtataagttagttttagaaggtgcgaaacaacttaagtgggaaccgggtaaa
attagatccatacaggacgatgaaattattgttaaaacaattgcaggagctataagcatt
ggggccgagttaccacagtataatggatccgatgttacggatacgaatcctttttatcca
agaaaaactggatatgaaagttatggtgaagtgattgaagttggtaataaagtaacacat
gtaaacgtaggcgataaagtagtttttttttatggacatgaaacaatagggatagttaag
gggcataaagtaattcgagtgcctagttctatacaacctaaagttgctttattatctatt
ctttcgtgtgatgccgctaaaggagtattgaaactaaacccgcaacaggatgaaaaagta
cttataactggaatgggagttattggtttactcgcttgttatttcttaaaatactatgta
ggcgttgagcacgtggatgttgttgagcctaataaaaatagaagagattttgcaaagaat
tttggtgcgaaaaacatatatgattcagaagaaaaaataatagaaacatataattatggt
ttcgaatgttctgctacaaatagtggatttcatgcattttaa

DBGET integrated database retrieval system