KEGG   Bacillus cereus G9842: BCG9842_B3091Help
Entry
BCG9842_B3091     CDS       T00815                                 

Gene name
asnO3
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bcg  Bacillus cereus G9842
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2095547..2097448
Genome map
AA seq 633 aa AA seqDB search
MCGFVGCLCENPREFSETEKHQFENMNTMIFHRGPDDEGYFRDEHVQFGFRRLSIIDLEA
GHQPLTYENDRYVIIFNGEIYNYVELREMLLEKGATFATQSDTEVIIALYAHMKEKCVDY
LRGMFAFMIWDREEKKLFGARDHFGIKPLYIAQQGDTTFFASEKKSIMHVMEDKGVNPTS
LQHYFTYQYGPEPETLTIDVNKIEPGHYFVKEIGKEMEIHRYWKPYFNASSATKEEHIQA
IRDVLYDSVKVHMRSDVPVGSFLSGGIDSSIIASIAREMNPNLLTFSVGFEQRGFSEVDV
AKETAEKLGVKNHNVFISAKEFMDEFPKIIWHMDDPLADPAAVPLYFVAKEARKHVTVVL
SGEGADELFGGYNIYREPNSLKMFSYIPSPGKSVLKALSGALKEGFKGKSFLERGCTPIE
ERYYGNAKIFREEEKAELMKYYNESVNYMDITKPLYNEIKDYDDVSKMQYIDMFTWLRGD
ILLKADKMTMANSLELRVPFLDKEVFDVASKIPTELKIANGTTKAILREAARGIVPDHVL
DRKKLGFPVPIRHWLKDEMHDWAINIINESKTEHLIDKQYVLNLLEAHCADKGDYSRKIW
TVLAFMVWHQIYVEHKYDTNKFHEETKRAYSLV
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttgtaggatgtttatgtgaaaaccctagagagttttcagaaacagaaaaa
catcaatttgaaaatatgaacacgatgattttccaccgtggtccagatgacgaaggatat
tttcgtgatgaacatgtacaatttggcttccgccgtttaagtatcattgacttagaggca
ggacatcagccgctaacttatgaaaatgatcgatatgtaattatttttaatggtgaaatt
tacaactatgtagaattacgtgaaatgttacttgaaaaaggtgcaacgtttgcaacgcaa
tctgatacagaagttattattgcattgtatgcacatatgaaagaaaaatgtgtagactac
cttcgtggtatgtttgcatttatgatttgggatcgtgaagagaagaaacttttcggtgca
cgtgaccacttcggtattaaacctctatacatcgcacagcaaggtgatactacattcttc
gcatctgagaagaaaagtattatgcatgtgatggaagataaaggcgttaatccaacgtca
ctacaacattattttacgtaccaatatggcccagagccagaaacattaacaattgatgtt
aataaaatcgagcctggtcattatttcgtaaaagaaatcggtaaagagatggaaatccat
cgctactggaaaccttatttcaatgcttcaagtgcaacgaaagaggagcatatccaagca
attcgtgatgtactatatgattcagtaaaagtgcatatgcgtagtgatgtaccagtaggt
tcattcttatctggtggtatcgattcatctatcatcgcttctattgcaagagaaatgaat
ccaaatcttttaacattctctgttggttttgagcaacgtggtttcagtgaagttgatgtt
gcaaaagaaactgctgagaaattaggcgttaaaaaccataacgtattcatttcagcgaaa
gaatttatggatgagttcccaaaaatcatttggcatatggatgatcctttagctgatcca
gcagctgtaccattgtacttcgttgctaaagaagcacgtaaacatgtaacagttgttctt
tcaggtgaaggcgcagacgagctatttggtggttataacatttaccgtgagccaaactca
ctaaaaatgttctcttacattcctagcccaggtaagagtgttctaaaagcattgagtggt
gctcttaaagaaggatttaaaggtaagagcttcctagagcgtggatgtacaccaattgaa
gagcgttactatggaaatgcgaaaatcttccgtgaagaagaaaaagctgaattaatgaag
tattacaatgaaagtgttaactatatggatatcacgaaaccattgtataacgagattaaa
gattatgatgatgtaagtaaaatgcagtacattgacatgttcacatggttacgcggtgac
attttattaaaagctgataaaatgacaatggcaaactcattagaacttcgtgtaccgttc
ttagataaagaagtattcgatgttgcatctaaaattccaactgaacttaagattgctaac
ggaactacgaaagctattttacgtgaagcagcacgcggaatcgttccagatcacgtatta
gatcgtaaaaaacttggattcccagtaccaattcgtcactggttaaaagacgaaatgcat
gattgggctataaatattataaacgaaagtaagacagagcatttaatcgacaaacagtat
gtattaaacttactggaagcacattgtgcagataaaggcgattatagccgtaaaatttgg
actgtacttgcgtttatggtatggcaccaaatttatgttgagcataaatacgatacgaac
aagttccatgaagaaacaaaacgtgcgtatagcttagtgtaa

DBGET integrated database retrieval system