KEGG   Bacillus cereus G9842: BCG9842_B3184Help
Entry
BCG9842_B3184     CDS       T00815                                 

Gene name
bsaA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bcg  Bacillus cereus G9842
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BCG9842_B3184 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BCG9842_B3184 (bsaA)
Enzymes [BR:bcg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BCG9842_B3184 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2003082..2003564
Genome map
AA seq 160 aa AA seqDB search
MTVYNFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKDQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKVDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttataatttttcagctaaaacaattacaggtgaagaaaaatcgttaaaagat
tacgaaggaaaagcacttcttattgtaaatgtagctagtaaatgtggtttcacaccgcaa
tataaaggattacaagaggtgtatgataaatataaagaccaaggactcgaaatactcgga
tttccttgtaaccaattcgggggacaagaaccaggtacagaagcggacattactagtttt
tgtgaattaaactacggtgtaaacttcccaatgtttgcaaaggttgatgtgaaaggtgat
aaggctcatcctttatatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtgaaatggaattttacgaagtttttaatcggaaaagacgggaaagtagtagggcgt
tttgcgccgcagacgaagccggtagatttagaggttgagattgagaaggtacttggagaa
taa

DBGET integrated database retrieval system