KEGG   Bacillus cereus G9842: BCG9842_B3241Help
Entry
BCG9842_B3241     CDS       T00815                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00010  Glycolysis / Gluconeogenesis
bcg00260  Glycine, serine and threonine metabolism
bcg00680  Methane metabolism
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01120  Microbial metabolism in diverse environments
bcg01130  Biosynthesis of antibiotics
bcg01200  Carbon metabolism
bcg01230  Biosynthesis of amino acids
Module
bcg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcg_M00002  Glycolysis, core module involving three-carbon compounds
bcg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B3241
  Energy metabolism
   00680 Methane metabolism
    BCG9842_B3241
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCG9842_B3241
Enzymes [BR:bcg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCG9842_B3241
Membrane trafficking [BR:bcg04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCG9842_B3241
Exosome [BR:bcg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCG9842_B3241
  Exosomal proteins of melanoma cells
   BCG9842_B3241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACK93951
UniProt: B7IU60
Position
1950060..1950650
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILHVHEGRADFELTEKGRQQVQKLVQKVKKDFAPDFIWASTLKRAR
ETGETLAEVIGCPIQLEEELMEFNNGIQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFNMPISMDYYFKMGDTGISLIEIEGE
QKTVHFINDTNHLDGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttacatgtgcatgaa
ggacgagctgattttgagttaactgaaaaagggagacaacaagtacaaaaacttgtacag
aaagtgaaaaaagattttgcaccagatttcatttgggcaagcacattaaaacgtgctcgt
gaaacgggtgaaacattagcagaagtaattggttgtccaattcaattagaagaggaatta
atggagtttaataatggaatacaagctggcttatcatttgaagaagcaaagaaatatcca
gaaccaaagtttcttcatgaccgttttgaaaacggagagtcatttattgagtttcgaatg
agaatagaagggattttttctaaaattgtgacagagaatacatatgatcgaattgcgatt
gttgcccatggaggcgtaattaatagtctattacgtgcatttttcaatatgccaatttca
atggactactatttcaaaatgggagatacgggaataagtttaattgaaattgagggtgaa
caaaaaacggtgcatttcattaatgatacgaatcatttggacgggatgtaa

DBGET integrated database retrieval system