KEGG   Bacillus cereus G9842: BCG9842_B3241Help
Entry
BCG9842_B3241     CDS       T00815                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcg  Bacillus cereus G9842
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCG9842_B3241
   01230 Biosynthesis of amino acids
    BCG9842_B3241
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B3241
  Energy metabolism
   00680 Methane metabolism
    BCG9842_B3241
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCG9842_B3241
Enzymes [BR:bcg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCG9842_B3241
Exosome [BR:bcg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCG9842_B3241
  Exosomal proteins of melanoma cells
   BCG9842_B3241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1950060..1950650
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILHVHEGRADFELTEKGRQQVQKLVQKVKKDFAPDFIWASTLKRAR
ETGETLAEVIGCPIQLEEELMEFNNGIQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFNMPISMDYYFKMGDTGISLIEIEGE
QKTVHFINDTNHLDGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttacatgtgcatgaa
ggacgagctgattttgagttaactgaaaaagggagacaacaagtacaaaaacttgtacag
aaagtgaaaaaagattttgcaccagatttcatttgggcaagcacattaaaacgtgctcgt
gaaacgggtgaaacattagcagaagtaattggttgtccaattcaattagaagaggaatta
atggagtttaataatggaatacaagctggcttatcatttgaagaagcaaagaaatatcca
gaaccaaagtttcttcatgaccgttttgaaaacggagagtcatttattgagtttcgaatg
agaatagaagggattttttctaaaattgtgacagagaatacatatgatcgaattgcgatt
gttgcccatggaggcgtaattaatagtctattacgtgcatttttcaatatgccaatttca
atggactactatttcaaaatgggagatacgggaataagtttaattgaaattgagggtgaa
caaaaaacggtgcatttcattaatgatacgaatcatttggacgggatgtaa

DBGET integrated database retrieval system