KEGG   Bacillus cereus G9842: BCG9842_B3581Help
Entry
BCG9842_B3581     CDS       T00815                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcg  Bacillus cereus G9842
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCG9842_B3581
   01230 Biosynthesis of amino acids
    BCG9842_B3581
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG9842_B3581
  Energy metabolism
   00680 Methane metabolism
    BCG9842_B3581
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCG9842_B3581
Enzymes [BR:bcg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCG9842_B3581
Exosome [BR:bcg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCG9842_B3581
  Exosomal proteins of melanoma cells
   BCG9842_B3581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1624624..1625199
Genome map
AA seq 191 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSEKGHCDAENVTHLLKDKHIDVVISSPYKRAIQTVQG
IANTYKLLIQTEEDLRERLLSTEPVADFNVAMQNVWKDWSFAYEGGESSDVAQRRAVICM
QNILKQYEGKNIVIGTHGNIMVLLMNYFNSKYDFEFWKTLHMPDVYKLNFDKNRFISAER
IEKTGHRLNIL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaatctatttcgttcgccatgcccactctacatatacaaaagaagaaagggaa
cgacctttatctgaaaaagggcactgtgatgcagagaatgtaacgcatttattaaaagat
aaacatattgatgttgttatttctagtccgtacaaaagagcgatccaaactgtacaagga
attgcgaatacatataaattattaatacaaacagaagaagatttgcgtgaaagattattg
agtacagagccagtagcagattttaatgttgctatgcagaatgtgtggaaagattggagt
tttgcatacgaaggcggagaatcgagtgatgtcgcacaaaggcgcgctgtaatatgtatg
caaaatatattaaaacaatatgaaggtaagaacattgtaataggtacgcatgggaatatt
atggtattactaatgaattattttaattcgaaatatgattttgagttttggaaaacactt
catatgcctgatgtgtataaattaaattttgataaaaatcgcttcatttctgctgaaaga
atagagaaaacaggtcatcggttaaatattttgtaa

DBGET integrated database retrieval system