KEGG   Bacillus cereus G9842: BCG9842_B4047Help
Entry
BCG9842_B4047     CDS       T00815                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00260  Glycine, serine and threonine metabolism
bcg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01130  Biosynthesis of antibiotics
bcg01230  Biosynthesis of amino acids
Module
bcg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCG9842_B4047 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCG9842_B4047 (trpA)
Enzymes [BR:bcg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCG9842_B4047 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB NMO
Motif
Other DBs
NCBI-ProteinID: ACK93578
UniProt: B7IM77
Position
1199117..1199893
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQIPFVLMTYLNPVLAFGKERFVEKCLEAGV
DGIIVPDLPYEEQNIIAPLLREANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKLHVNLPVVAGFGISTKEHVEEMVTICDGVVVGSKIIELLENE
KREEICELIYATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcgtttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggacttgagaaattaaaagaaagaattcgttttctagacgaa
gcaggagcaagcatcgttgaaattggtatcccgttttcagatccagttgcagatggccca
acgattcaaagagcagggaagcgagcgctagatagcggtgtaacagtaaaaggtattttt
caagcattaatagaggtaaggaaagaagtgcaaattccgtttgtactcatgacatattta
aatccagtactcgcattcggaaaagaacgatttgtagagaagtgcttagaggccggtgtg
gatggtattatcgttccagacttaccgtatgaagaacaaaatattattgcgccgttactt
cgagaggcaaacattgcgcttattccactcgttaccgtaacgagccctattgaaagaatt
gaaaaaatcacgagtgaatcagaagggttcgtttatgctgttacagtagcgggcgtaacg
ggagtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaattacac
gtcaacttaccagtagtcgctggatttggcatttcaacaaaagaacatgtagaagaaatg
gttacaatatgtgacggagttgttgttggaagtaagatcattgagcttttagaaaatgaa
aaacgagaagaaatatgtgaattaatatatgcaacaaaacaaaaagaagaggcgtaa

DBGET integrated database retrieval system