KEGG   Bacillus cereus G9842: BCG9842_B4047Help
Entry
BCG9842_B4047     CDS       T00815                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcg  Bacillus cereus G9842
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCG9842_B4047 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCG9842_B4047 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCG9842_B4047 (trpA)
Enzymes [BR:bcg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCG9842_B4047 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1199117..1199893
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQIPFVLMTYLNPVLAFGKERFVEKCLEAGV
DGIIVPDLPYEEQNIIAPLLREANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKLHVNLPVVAGFGISTKEHVEEMVTICDGVVVGSKIIELLENE
KREEICELIYATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcgtttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggacttgagaaattaaaagaaagaattcgttttctagacgaa
gcaggagcaagcatcgttgaaattggtatcccgttttcagatccagttgcagatggccca
acgattcaaagagcagggaagcgagcgctagatagcggtgtaacagtaaaaggtattttt
caagcattaatagaggtaaggaaagaagtgcaaattccgtttgtactcatgacatattta
aatccagtactcgcattcggaaaagaacgatttgtagagaagtgcttagaggccggtgtg
gatggtattatcgttccagacttaccgtatgaagaacaaaatattattgcgccgttactt
cgagaggcaaacattgcgcttattccactcgttaccgtaacgagccctattgaaagaatt
gaaaaaatcacgagtgaatcagaagggttcgtttatgctgttacagtagcgggcgtaacg
ggagtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaattacac
gtcaacttaccagtagtcgctggatttggcatttcaacaaaagaacatgtagaagaaatg
gttacaatatgtgacggagttgttgttggaagtaagatcattgagcttttagaaaatgaa
aaacgagaagaaatatgtgaattaatatatgcaacaaaacaaaaagaagaggcgtaa

DBGET integrated database retrieval system