KEGG   Bacillus cereus G9842: BCG9842_B4048Help
Entry
BCG9842_B4048     CDS       T00815                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcg  Bacillus cereus G9842
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCG9842_B4048 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCG9842_B4048 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCG9842_B4048 (trpB)
Enzymes [BR:bcg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCG9842_B4048 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1197920..1199113
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMQDEAFQKELNHYLKTYVGRET
PLYFAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPKMKKDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaagcgatgcaa
gatgaagcgtttcaaaaggaattaaatcattatttaaaaacgtacgttggaagggaaaca
ccgctttatttcgctgaaaatatgacgaagtattgcggtggtgcaaagatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaacaatacaatcggtcaggcacta
cttgcagtacgaatgggcaagaaaaaagttgtcgctgaaacaggagcaggacaacacgga
gtggcaactgctactgtatgtgccctactcggattagaatgcgtcatctttatgggagag
gaagatgtgagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagcggcaggtagcggcacattaaaagatgcagtgaacgaggcgcttcgctac
tgggtttcacacgtgcacgatacacactacattatgggatccgttctcgggccacatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattggaaatgaaacgaaaaaacaatat
gaggcgttagaaggaaagttaccagaagcagtcgttgcttgtattggcggtggtagtaat
gcgatgggcatgttttatccgttcgtacacgatgaagaggtcgctctttacggcgtagaa
gcagcagggaaaggcgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtc
ggtgttttacacggatcaatgatgtatcttctgcaaaacgaagaagggcaaattcaagaa
gcgcactctatttcagcaggactcgattatccaggtgttggtccagaacatagcttgcta
aaagatattggccgcgtttcttatcattcaattactgatgatgaagcgttagaagcattt
caattattaacgaaaaaagaaggaattattccggctttagaaagctcacatgctgtcgca
tatgcattaaaattagcgccgaaaatgaagaaagacgaaggacttgtcatttgcttatca
ggccgcggtgataaagatgtagagagtataaaacgttatatggaagaggtgtga

DBGET integrated database retrieval system