KEGG   Bacillus cereus G9842: BCG9842_B4050Help
Entry
BCG9842_B4050     CDS       T00815                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01130  Biosynthesis of antibiotics
bcg01230  Biosynthesis of amino acids
Module
bcg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCG9842_B4050
Enzymes [BR:bcg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCG9842_B4050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACK97912
UniProt: B7IM74
Position
1196551..1197312
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVEQKKKEVAELYETYTPVKTKRKTHSLVEALQQFTVIAEVKRASPSKGDINL
HVDVRKQVGTYEDCGAGAVSVLTDGQFFKGSFHDLQTAREESNIPLLCKDFIIDKIQIDR
AYETGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEQELETAIQLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGIHSKEDITRVKRAGAKGVLVGEALMTSS
SISSFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagataaaattgtagaacagaagaaaaaggaagttgcggagttatat
gaaacgtatacaccagtcaaaacaaaaagaaagacacattcacttgtagaagcgttacag
cagtttactgtcattgcagaagtaaagcgagcatcaccatcaaaaggagatatcaattta
cacgttgacgtacgaaaacaagtgggaacatatgaagactgcggggcaggagcagtatct
gttttaacagatggtcaattttttaaaggatcgtttcacgatttacaaacagcaagagaa
gaaagtaacattccgcttttatgtaaagatttcataatcgataagattcaaatcgataga
gcgtatgaaacgggagcagatattattttactaatcgtagcagcgttaacgaaagaaaag
ttaaaagagttgtatagctacgtgttagaaaaaggattggaagcgattgttgaagttcat
gatgaacaggaattagaaactgcgatccaactaaatccacatgttattggcattaataat
cgtaatttaaaaacgttcgaagtagatttaagccaaactgaaaagttaggaaaacgattg
aatgaggagaaattactttggattagtgaaagtggcattcattcaaaagaagatattacc
cgcgttaaaagagctggagcaaaaggtgtattagttggagaggcacttatgacatcatct
tctattagtagcttttttgaagattgtaaggtgaatatatga

DBGET integrated database retrieval system