KEGG   Bacillus cereus G9842: BCG9842_B4073Help
Entry
BCG9842_B4073     CDS       T00815                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bcg  Bacillus cereus G9842
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BCG9842_B4073 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCG9842_B4073 (rfbC)
Enzymes [BR:bcg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BCG9842_B4073 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178280..1178825
Genome map
AA seq 181 aa AA seqDB search
MKVVETNFIDAKLLEPRLFGDERGFFSESYNKQVLETLGITYSFVQDNVSYSAKAGTIRG
LHFQKKPKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSADNHRQLLVPKGFAHG
FCTLVPHTIVMYKVDEYYSAEHDSGLLWEDKDLAIPWPVTDPILSDKDQILPLLEEYEDS
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgtagaaacaaattttatcgatgcaaaattgttagaaccgaggttgtttgga
gacgagcgtggctttttttcagaaagctataataagcaggtgctagaaacattagggatt
acgtattcatttgtacaggataacgtatcttattcggctaaggcaggaacgattcgggga
ctacactttcaaaaaaaaccgaaagcacaaacgaaactcattcaagttatgcaaggggca
atttatgatgttatcgttgatttacgaaaaaaatcaccaacatttaaacaatggaaaggg
tatattttaagtgcagataaccatcgacaattactagtgccaaaagggtttgcgcatgga
ttttgcacccttgttccgcatactatcgttatgtataaagtagatgaatattatagcgca
gagcatgactcaggattactttgggaagataaagatttagcaattccttggccagtaacc
gatcctatattgtccgataaggatcagatattaccattactagaggaatatgaagatagt
ttttaa

DBGET integrated database retrieval system