KEGG   Bacillus cereus G9842: BCG9842_B4086Help
Entry
BCG9842_B4086     CDS       T00815                                 

Definition
ribosomal large subunit pseudouridine synthase, RluA family
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bcg  Bacillus cereus G9842
Brite
Enzymes [BR:bcg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BCG9842_B4086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1165691..1166518
Genome map
AA seq 275 aa AA seqDB search
MKTKGISKAALTDIKFHGGAIEVNGQHASVRHQLRASEELRIFFPVEERSEGMIAEDIPL
CIVYEDDAVLIINKEANMSTIPSREHPTGSVANALLSHYDKQHLASTVHIVTRLDRDTSG
LMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGMIDAPIGRKSDSIIERTVCE
DGQRAVTHFKVIDSTYHKTHVALELETGRTHQIRVHMAHIGHPLLGDNLYGGRRDEMKRQ
ALHSKSLTFYHPILEKEMSFTIKIPSDMQELLRNA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacgaaaggtatttctaaagccgctttaacggatataaagtttcacggcggggca
attgaagtaaatggtcaacatgcgagtgttcgtcatcagttgcgcgctagtgaagaatta
cgcatcttttttccagtggaggaaagaagtgaagggatgattgcagaagatatcccttta
tgcattgtatatgaagatgatgcggttcttatcattaataaagaggcgaacatgtcaacg
attccatctagggaacatccgacagggagtgttgccaatgcgcttttatctcattatgat
aagcagcatcttgcaagtacagtacacattgtaacacggttagatcgtgatacttcaggg
cttatgcttattgcaaaaaatcgtttcgtgcatcatcttttatcgaagcagcatcaacaa
aaagctgtgaaacgaacgtatgaagcaattgttcacggtgagatggtagaacgagaagga
atgattgatgcaccaattggtcggaaatctgatagcattattgagcgaacggtttgtgag
gatggacaaagggcagttactcattttaaagtaattgatagtacatatcataagacacat
gtagcgctggagcttgagacaggaagaacgcatcaaattcgtgtgcatatggctcatata
ggacatccattacttggtgataacttatatggaggaagaagggatgaaatgaaacggcaa
gcacttcatagtaaatctttgacgttttatcatcctattttagagaaagaaatgtctttc
actataaagattccaagcgatatgcaagagttacttaggaatgcttaa

DBGET integrated database retrieval system