KEGG   Bacillus cereus G9842: BCG9842_B4134Help
Entry
BCG9842_B4134     CDS       T00815                                 

Gene name
asnO1
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bcg  Bacillus cereus G9842
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCG9842_B4134 (asnO1)
Enzymes [BR:bcg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BCG9842_B4134 (asnO1)
Peptidases [BR:bcg01002]
 Cysteine Peptidases
  Family C44
   BCG9842_B4134 (asnO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117154..1119001
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDYKRSLEGERDVVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGK
QPMTCLKDETNYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEECVDH
LNGIYAFAVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILSHPDVKAEVTLE
GLSEIFGLGPSRTPGHGIYAGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEETVE
KTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYARSGKGQLHTYSVDYEDND
KYFKANAFQPNSDAPFINLMTETFQTTHHRCVISNEQLAEYLTEAVLVRDLPGMADIDSS
LLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKKEWR
NKLNLQQYVQRRYEESIQEVPILEGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEDVLPHDILYRKKSPYPKTHNP
HYTKAVTVWLQNLLTDKGSILHELFDKEQLSGLIQSGGSAFQTPWFGQLMTGPQLLAHLA
QIHVWFKEYGVNIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattacaggatgggtggattataaacgctcattagaaggagaaagagatgtc
gttacgaagatggctgagacgttagcgaaacgcggtccagatgataataaagtttggatt
aaaggtaatgtcgcatttgggcataaacggttaatcgttgttgatcctgagggtggtaaa
caaccgatgacttgtttaaaagatgaaacgaattatgccatttgttataacggtgaactt
tataacacagaagacattcgaaaggaattattaagaagaggatatacgttcaaaggtcat
tctgatacagaagtattattagcttcttatattgaatggaaagaagaatgtgtcgatcat
ttaaacggtatatatgcgtttgcagtatgggacgaacagaaagaacaagtatttattgcg
agagatcgattaggtgtaaagccacttttttataaatatgatagcggacgcttattattt
ggttcggagttaaaagcgatattgtcgcatccagatgtgaaggcagaagtaacattagaa
ggattatcagaaatattcggactcggaccgtcaagaacacctggccacggtatttatgct
ggtataaaagaattacgtccaggtcatgcgatgacattttcaaagaacggtttatgtata
tggagatattggaatgtggaaagtaaaaaacatgaagactcctttgaagaaacagtagag
aaaacacgctttttattacaagatgcgattacaaggcagctcgtttctgatgtaccacta
tgtacttttctatcaggcggtgtagattcgagcgctataacagcaattgctgcgaaagaa
tatgcaaggtcaggaaaagggcaattacacacatattctgttgattatgaagataatgac
aaatactttaaagcgaatgcgtttcagccaaattcagatgctccgtttattaatttaatg
actgagacatttcaaacaacccatcatcgctgcgtcatttcgaatgaacaattagcagag
tatttaactgaagcggtactcgttcgtgatttgcctggtatggcagatatcgattcgtca
ttattatggttttgccgagaaattaaacaagattttgtcgttggcttatctggagaatgt
gcagatgaaatatttggtggatatccgtggttttatagagaagatgatttacaatcgagt
gcatttccgtggatgcgttctacagaggcacgtgaacaacttctaaaaaaagaatggaga
aataaactaaatttacaacaatatgtacaaaggcgctatgaggaatcgattcaagaagtt
cctattttagagggggaaagtccactagaagcaaaaagacgccaattattttatttaaat
atggtatggtttatgacaacattattagacagaaaagaccgtatgagtatgggggcaagt
ttagaagtacgcgttccatttgcagatcatcgtcttgtcgaatatgcgtggaatattcct
tgggaaatgaaaatgtataaaaaccgcgaaaaaggtctattacgtaaagcgttagaagat
gtactcccacatgacatcttatataggaagaagagtccttatccgaaaacgcacaatcca
cactatacaaaggcagtaacggtatggcttcaaaatctattaacagataaaggttcaatt
ttacacgaactatttgataaagagcagttgagcggattgattcagtctggtggcagtgca
tttcaaacaccgtggtttggtcaattgatgactgggccacagcttttagctcatttagca
caaattcatgtttggtttaaagagtatggggtaaatattaaagaatag

DBGET integrated database retrieval system