KEGG   Bacillus cereus G9842: BCG9842_B4158Help
Entry
BCG9842_B4158     CDS       T00815                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bcg  Bacillus cereus G9842
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCG9842_B4158 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCG9842_B4158 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCG9842_B4158 (aceB)
Enzymes [BR:bcg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BCG9842_B4158 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094534..1096123
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEVLSFLKELHENFNERRIELLQKRVEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAVEGQINLRDAVKGTISHENDKGKEYRLNEKTAVLIVRPRGWHLEEKHMQVDGEN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKSFRNHNKFLLPDRAQVTM
TAPFMRSYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEICVTENDLLEVPVGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATMLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgttggagaaatgttaccagcgtacaacgaa
atattgacacctgaggtgcttagttttttgaaggaactacatgagaattttaatgagcgc
cgcatagaacttttacaaaaacgtgtagaaaaacaaaagagaattgatgcaggggagttt
ccgaagtttctagaagaaacaaaacacatacgtgaagcggattggacaattgccaagctg
ccaaaagacttagaggatcgccgcgtagagattactggaccggtagatagaaagatggtc
attaacgctttaaattcaggagcgcatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcagtggaaggtcaaatcaacttacgagatgcagtaaagggaacg
atttcacatgaaaatgataaagggaaagaatatagattaaatgagaaaacagctgtactc
attgtacgtccaagaggatggcatttagaggaaaagcatatgcaagttgatggggaaaat
atgtcaggtagcttagtagatttcggcttgtactttttccataatgcgaaagctctttta
gcaaaagggagcggcccatacttttacttaccgaaaatggaaagttatttagaagcgaga
ttatggaatgatgtattcgtatttgctcaaaaatatatcggcattccaaatggaacgatt
aaagcaactgtgttactggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagctaaaagatcattctgctggcttaaactgtggaagatgggattatatttttagcttt
ttaaagagtttccgtaatcataataaattcttactaccagatagagcacaagtcacgatg
acagcgccatttatgcgttcgtattctttgaaagtaattcaaacgtgtcaccgccgtaat
gcaccagcaattggaggaatggcggcacaaattccgattaaaaataatccagaagcgaat
gaagcagcttttgaaaaagtgcgtgctgataaggagcgcgaagctttagacggtcatgac
gggacttgggttgctcaccctggacttgtaccggttgcaatggaagtatttaatcacatt
atgaaaacaccaaatcaaattttcagaaaacgtgaagaaatatgtgtaacagaaaacgat
ttactagaggtaccggtgggaacgattacagaagagggccttcgcatgaatattagcgta
ggtattcaatatattgcatcttggttaagcggacggggagcagcacccatttataactta
atggaagatgcggcaactgctgaaatttcaagagcacaagtatggcaatggattcgtcat
gaaggtggaaaactaaatgatggtcgtaatattacgcttgaattaatggaagagctaaaa
gaagaagaattagcaaaaatagaaagagagattggtaaggaagcctttaagaaagggaga
ttccaagaggcgacaatgttgtttacaaatctcgttcgaaatgatgaattcgtaccattt
ttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system