KEGG   Bacillus cereus G9842: BCG9842_B4158Help
Entry
BCG9842_B4158     CDS       T00815                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bcg  Bacillus cereus G9842
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bcg01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bcg00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bcg00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094534..1096123
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEVLSFLKELHENFNERRIELLQKRVEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAVEGQINLRDAVKGTISHENDKGKEYRLNEKTAVLIVRPRGWHLEEKHMQVDGEN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKSFRNHNKFLLPDRAQVTM
TAPFMRSYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEICVTENDLLEVPVGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATMLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgttggagaaatgttaccagcgtacaacgaa
atattgacacctgaggtgcttagttttttgaaggaactacatgagaattttaatgagcgc
cgcatagaacttttacaaaaacgtgtagaaaaacaaaagagaattgatgcaggggagttt
ccgaagtttctagaagaaacaaaacacatacgtgaagcggattggacaattgccaagctg
ccaaaagacttagaggatcgccgcgtagagattactggaccggtagatagaaagatggtc
attaacgctttaaattcaggagcgcatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcagtggaaggtcaaatcaacttacgagatgcagtaaagggaacg
atttcacatgaaaatgataaagggaaagaatatagattaaatgagaaaacagctgtactc
attgtacgtccaagaggatggcatttagaggaaaagcatatgcaagttgatggggaaaat
atgtcaggtagcttagtagatttcggcttgtactttttccataatgcgaaagctctttta
gcaaaagggagcggcccatacttttacttaccgaaaatggaaagttatttagaagcgaga
ttatggaatgatgtattcgtatttgctcaaaaatatatcggcattccaaatggaacgatt
aaagcaactgtgttactggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagctaaaagatcattctgctggcttaaactgtggaagatgggattatatttttagcttt
ttaaagagtttccgtaatcataataaattcttactaccagatagagcacaagtcacgatg
acagcgccatttatgcgttcgtattctttgaaagtaattcaaacgtgtcaccgccgtaat
gcaccagcaattggaggaatggcggcacaaattccgattaaaaataatccagaagcgaat
gaagcagcttttgaaaaagtgcgtgctgataaggagcgcgaagctttagacggtcatgac
gggacttgggttgctcaccctggacttgtaccggttgcaatggaagtatttaatcacatt
atgaaaacaccaaatcaaattttcagaaaacgtgaagaaatatgtgtaacagaaaacgat
ttactagaggtaccggtgggaacgattacagaagagggccttcgcatgaatattagcgta
ggtattcaatatattgcatcttggttaagcggacggggagcagcacccatttataactta
atggaagatgcggcaactgctgaaatttcaagagcacaagtatggcaatggattcgtcat
gaaggtggaaaactaaatgatggtcgtaatattacgcttgaattaatggaagagctaaaa
gaagaagaattagcaaaaatagaaagagagattggtaaggaagcctttaagaaagggaga
ttccaagaggcgacaatgttgtttacaaatctcgttcgaaatgatgaattcgtaccattt
ttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system