KEGG   Bacillus cereus G9842: BCG9842_B4200Help
Entry
BCG9842_B4200     CDS       T00815                                 

Gene name
hemY1
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bcg  Bacillus cereus G9842
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCG9842_B4200 (hemY1)
Enzymes [BR:bcg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BCG9842_B4200 (hemY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1056106..1057527
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAKPKKGIFQTVKTGLESIVESLEVKMH
EGTIIKGTRIEKVAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNI
PATSVANVALAFQKSAIRRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKK
LTTFMQKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtgatcgtcggcggaggcataacgggattaacagcaatgtataac
ttacaaaaaaatattcatgaaaaaaacttgccgattgatacattacttatagaagcatcg
ggtaaacttggcggaaaaattcaaaccgttcgaaaagatggatttacaattgaacgcgga
ccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgaacttgtaaataatcaagccggtcaatcatttatcctcgtaaacaatcggtta
cataaaatgccgagcggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tccgggctgttctccccaattggtaaactaagagctggttttgatctattaatgccgagg
tcaaagccagtatctgaccaatcactcggacaatttttcagacatcgcctcggaaacgaa
gtggttgaaaacttaatagaaccgttactatcgggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcagattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgctccgaaagaagagaaagctaaaccgaaaaaaggaatc
ttccaaacagtgaaaacaggtttagaatctatcgtagaatctctcgaagtaaagatgcat
gaaggtacgataataaagggaactcgcattgaaaaagttgcaaaacagggtgatggttat
acaattactcttagtaatggaaaagaaatagaagcggacgccatcgtagtggcaacttcg
cataaagtattgccgtccatgtttgctcagtacaagcagtttcgttttttccgtaatatt
ccggccacatccgttgcgaatgtggcacttgctttccaaaagtcagcaatccggcgcgat
attaatggtacaggatttgtcgtatcacgaaatagcgattacacgattacagcatgtacg
tggacgcataaaaaatggccacatacaacgccagaaggaaaaacactccttcgctgttac
gttggacgtgctggtgatgaagcggttgtagaacaaactgaagaagaactcgttcagctc
gtactagaagatttaagaaaaacgatggatattacagaggatccagaatttacaatcgta
agccgctggaaagaagcgatgcctcaatatacagtaggccataatgagcgaatgaaaaag
ctcacaacatttatgcagaaagagttgcctggtatatacttggcaggtagctcctatgct
ggtgctggacttccagattgtattaatcaaggtgaggaagctgcaaagcgtgtattatct
catttggagaaagtaatagatgctgaattaatcgcacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system