KEGG   Bacillus cereus G9842: BCG9842_B5138Help
Entry
BCG9842_B5138     CDS       T00815                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bcg  Bacillus cereus G9842
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcg01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bcg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152498..153391
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDE
NTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHSSLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIITSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatttcagttattggagttccaatggatttaggacagatgcgtcgtgga
gttgatatgggaccgagcgcgatccgttatgcaggggtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaggtagatgaa
aatacaaaattaagaaaccttacacaagttgcaactgtatgtaatgaattagcaagtaag
gtggatcatattatagaagaaggtcgttttccacttgtattaggtggtgaccatagtatt
gctatcggtacattagctggtgtagccaaacattataaaaacttaggtgttatttggtat
gatgcacacggtgatttaaatacagaggaaacttcaccatctggaaatattcacggtatg
tcacttgcagcaagtttaggttatggacattcttcacttgtagatttatacggagcatat
ccaaaggtgaaaaaagagaatgttgtaattatcggtgcgcgtgcattagatgaaggagaa
aaagacttcattcgcaatgaaggtattaaagtgttctcgatgcatgaaattgatcgtatg
gggatgacggctgttatggaagaaacaatcgcatatttatctcatactgatggtgtacac
ttatcattagatttagatggtcttgatcctcatgatgcaccaggtgttggaacgcctgta
attggtggtctatcttatcgtgaaagccacttggcgatggaaatgttagcggaagctgat
attatcacatctgctgaatttgttgaggtaaatacgattttagatgagagaaatagaacg
gcaacaacagcagttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system