KEGG   Bacillus cereus G9842: BCG9842_B5138Help
Entry
BCG9842_B5138     CDS       T00815                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00220  Arginine biosynthesis
bcg00330  Arginine and proline metabolism
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01130  Biosynthesis of antibiotics
bcg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BCG9842_B5138 (rocF)
   00330 Arginine and proline metabolism
    BCG9842_B5138 (rocF)
Enzymes [BR:bcg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BCG9842_B5138 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACK94298
UniProt: B7ITV6
Position
152498..153391
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDE
NTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHSSLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIITSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatttcagttattggagttccaatggatttaggacagatgcgtcgtgga
gttgatatgggaccgagcgcgatccgttatgcaggggtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaggtagatgaa
aatacaaaattaagaaaccttacacaagttgcaactgtatgtaatgaattagcaagtaag
gtggatcatattatagaagaaggtcgttttccacttgtattaggtggtgaccatagtatt
gctatcggtacattagctggtgtagccaaacattataaaaacttaggtgttatttggtat
gatgcacacggtgatttaaatacagaggaaacttcaccatctggaaatattcacggtatg
tcacttgcagcaagtttaggttatggacattcttcacttgtagatttatacggagcatat
ccaaaggtgaaaaaagagaatgttgtaattatcggtgcgcgtgcattagatgaaggagaa
aaagacttcattcgcaatgaaggtattaaagtgttctcgatgcatgaaattgatcgtatg
gggatgacggctgttatggaagaaacaatcgcatatttatctcatactgatggtgtacac
ttatcattagatttagatggtcttgatcctcatgatgcaccaggtgttggaacgcctgta
attggtggtctatcttatcgtgaaagccacttggcgatggaaatgttagcggaagctgat
attatcacatctgctgaatttgttgaggtaaatacgattttagatgagagaaatagaacg
gcaacaacagcagttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system