KEGG   Bacillus cereus G9842: BCG9842_B5235Help
Entry
BCG9842_B5235     CDS       T00815                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bcg  Bacillus cereus G9842
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78449..78964
Genome map
AA seq 171 aa AA seqDB search
MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIQVDDISSIYETEPVGYTDQSCFLNLVI
KISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQENIEAENLIVPHPRMF
ERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGEDAFVLFES
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagcatacattgcattagggtcaaatattggagagcgttatacgtatcta
accgaagcgattcagttcttaaataaaaatccttatattcaggttgatgatatttcatct
atatatgaaactgagccagttggctatactgaccaaagttgctttttaaatttagttata
aaaatttctaccaatttatcaccacaagaattattgaaagtaacacaaaaagtagaaaat
gacctaggaagaaaaagggaaattaggtgggggccgaggactatcgaccttgacatttta
ctttataatcaagagaatattgaagcagagaatcttattgttccgcatccgcggatgttt
gaaagagcttttgttatcgttccgttgttagagattaatcaagacataaaacaaaacatt
tcacgttcacaagtagaagaaatgaaaaggcgagagggagtaacggtatggaagcagaaa
aatggggaagacgcattcgtgcttttcgaaagctaa

DBGET integrated database retrieval system