KEGG   Bacillus cereus G9842: BCG9842_B5237Help
Entry
BCG9842_B5237     CDS       T00815                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcg  Bacillus cereus G9842
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77256..78089
Genome map
AA seq 277 aa AA seqDB search
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMQGEGAHII
DIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIIN
DIWGAKAEPIIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKNAGVRDEN
IILDPGIGFAKTPKQNLEVMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGA
TVCLGIEKGCEFVRVHDVKEMARMAKMMDAMIGKGVK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgggattatgatttacgctgcggcgaatatacattgaatttaaatgaaaagaca
ttaattatggggattttaaatgtaacaccagattcgttttctgatggtgggagttacaac
gaggtagatgctgcggtacgtcatgcaaaagaaatgcaaggtgaaggtgctcatattatt
gatattggtggcgaatctactcgcccgggttttgctaaagtatcagtagaagaagaaata
aagcgagttgtcccgatgattcaagcggtttcaaaagaagtgaaattgcctatatctatc
gatacatataaagctgaagttgcaaagcaagcaattgaggctggtgctcatattattaat
gatatttggggagcgaaggcggagccaataattgctgaagtcgcagctcattatgatgta
cctatcattttaatgcataaccgcgataatatgaattatcgtaatttaatggcggatatg
attgctgatttgtatgatagtatcaaaattgctaaaaatgctggtgtgcgagatgagaat
attattttagatccaggtatcggttttgctaaaacacctaagcaaaacttagaggtgatg
cgtaatttagaacagttaaatgtgctaggttatccggttctcttaggtacatcgagaaag
tcctttattgggcacgtattagatttgccagtagaggaacgccttgagggaacgggagct
actgtttgtcttggtattgaaaagggttgtgagtttgttcgtgtccatgatgtgaaagaa
atggcgcgtatggctaaaatgatggatgcaatgattggtaagggggtaaagtaa

DBGET integrated database retrieval system