KEGG   Bacillus cereus G9842: BCG9842_B5266Help
Entry
BCG9842_B5266     CDS       T00815                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00900  Terpenoid backbone biosynthesis
bcg01100  Metabolic pathways
bcg01110  Biosynthesis of secondary metabolites
bcg01130  Biosynthesis of antibiotics
Module
bcg_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCG9842_B5266 (ispE)
Enzymes [BR:bcg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BCG9842_B5266 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Peptidase_C42
Motif
Other DBs
NCBI-ProteinID: ACK96748
UniProt: B7ISV5
Position
47843..48712
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELTELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDELAELGAEIGSDVSFCVYGGTAIATGRGEKIEHIKTPPSCWVILAKPHIGVSTADV
YGNLKLNRVTHPNVDKMVDVINSGDYKGICDTVGNVLEDVTFGMHPEVARIKSQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagacggatatcatgaagtgaaaatgattatgacaaccattgatttagcagatcgt
ctagaactaacggaattagcagaagaccgtattgaaattttatcccataatcggtatgtc
ccagacgaccaacgaaatttagcttatcaggcagcgaaattattaaaagagaagtttaat
gtaaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagctggattagca
ggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatggaatttaggg
cttacaattgatgagttagcagagcttggcgcagaaattggatcagatgtatcgttctgt
gtatacggcggcacagcaattgccactggaagaggagagaaaattgagcatataaagact
ccgccttcttgttgggttattttagcgaaaccacatataggtgtatctactgctgatgtg
tatggaaatttaaagttaaatcgagttacacatccaaatgtagataaaatggttgatgtc
ataaattctggagattataaagggatttgtgatactgttggtaacgttttagaagatgta
acatttggaatgcatcctgaagttgcacgtattaaatcacagatgaagcgattcggagcg
gatgctgtattgatgagtggaagtggtccaactgtatttggacttgtacaccatgattct
cgaatgcatcgcatttataacgggttaaaaggattttgtgaacaggtctatgcggtacgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system