KEGG   Bacillus cereus G9842: BCG9842_B5292Help
Entry
BCG9842_B5292     CDS       T00815                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bcg  Bacillus cereus G9842
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCG9842_B5292 (recR)
DNA repair and recombination proteins [BR:bcg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BCG9842_B5292 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27414..28010
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagagccaatatcaaaactaatcgatagttttatgaagttgccaggtatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagatgatgtg
ttaggttttgcgaaagcacttgtaaatgcgaagcgagatttagcgtattgttctgtatgt
ggacatattactgatcgtgatccttgttatatttgtaatgattcgcatcgagatcaatca
gttgtttgtgtcgtgcaagaaccgaaagatgtaatcgcgatggaaaaaatgaaagagtat
caaggtgtatatcatgtgttacgtggtgcgatttctcctatggagggaattggaccggaa
gacattaatatcccgcaactcttaaagcgactacatgatgaaacggtacaagaagtaata
ttagcaacaaaccctaatattgaaggggaagctacagcgatgtatatctcccgcctctta
aaacctacaggcattaaagtaactcgtattgcacatggtctgccagttggtggagattta
gaatatgcagatgaagtgacactatcgaaagcgttagaaggtcgcagagaagtataa

DBGET integrated database retrieval system