KEGG   Bacillus cereus G9842: BCG9842_B5299Help
Entry
BCG9842_B5299     CDS       T00815                                 

Definition
deoxynucleoside kinase (EC:2.7.1.-)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bcg  Bacillus cereus G9842
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bcg00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bcg00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22303..22971)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatatacccaatgatgcagtaatcactatcgccggaacg
gtaggtgtgggtaaatcaactatgacaactgcattagctaatgctttaggttatcgcaca
tcatttgaaaaagtagattccaatccatatttggacaaattctatgcggacttcactcgc
tggagcttccacctacaagtgtactttttagcagaacgatttaaggaacaaaaaagaatt
tttgaatatggtggcggttttgttcaagatcgttccatttacgaagacactggaattttc
gcaaagatgcatcatgaaaaaggtacaatgacggaaactgattatgaaacatacaaaggt
ttatttgacgctatggtcatgactccttacttccctcatccagacttattaatttactta
gaaggttctttcgatgatattgtcgatcgcattcaagaacgtgggcgcccaatggaacag
caaacaccaattgagtactggaaagaaatgcatggacgttatgaaaactggattaacaac
tttaattcatgtcctgtattacgcttaaatattaatgagtacgatattttaaaagatggt
gattcaatcgaaccaatcattaaaaaaattggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system