KEGG   Bacillus cereus G9842: BCG9842_B5556Help
Entry
BCG9842_B5556     CDS       T00815                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bcg  Bacillus cereus G9842
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCG9842_B5556 (galU)
   00052 Galactose metabolism
    BCG9842_B5556 (galU)
   00500 Starch and sucrose metabolism
    BCG9842_B5556 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BCG9842_B5556 (galU)
Enzymes [BR:bcg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCG9842_B5556 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5147178..5148056)
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAMESGIEDIIVVTGKG
KRAIEDHFDHSFELEQSLLEKGKYEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVKAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQNDR
RYQVRQFVEKPEQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQ
RVFAYDFEGIRYDVGEKFGFIKTTIEMALQNEELRESLIDYMDGILKKRKNI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaggcaattattccagcggctggtcttgggacaaggtttttacca
gcaacgaaagcaatgccgaaagaaatgttacctatcgttgataaaccgacaattcaatac
ataatagaagaagcgatggaatcaggaattgaagatattattgttgtcacaggaaaagga
aagcgcgcaatcgaagatcattttgatcattcttttgaattagaacaaagccttttagaa
aaagggaagtatgaaatgcttgaaaaagtacaagcttcttcaaaaattaatattcattac
ataagacaaaaggaaccaaaaggtttaggacacgcagtatggtgtgcacgtaaatttatt
ggaaatgaaccatttgcggtattacttggtgatgatattgtgaaagcagaaacgccatgt
ttgcgtcaattaatggatcaatatgaaggaacacaatcatctgttataggtgtacaaaca
gtaccagaaaatgaaacgcatcgttacggtattatcgatccagttgaacaaaatgatcga
cgttatcaagtacgtcaatttgtagagaagccagagcaaggaacagcaccatcaaactta
gctattatgggtcgttacgtattaacaccagaaatttttatgtttctagagaatcaacaa
acaggtgcaggcggcgaaattcaattaacagatgcgattcaacgattaaatgaaattcag
cgtgtgtttgcttatgactttgaagggattcgttatgatgttggggagaaatttggattt
attaagacgacaattgagatggcattacaaaatgaagagttaagagagtcattaatagat
tatatggatggaattttgaagaagagaaaaaatatatag

DBGET integrated database retrieval system