KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0027Help
Entry
Bcen2424_0027     CDS       T00415                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bch  Burkholderia cenocepacia HI2424
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(28136..31162)
Genome map
AA seq 1008 aa AA seqDB search
MRLHFEADLDYQREAIDAVCDLFRGQESYRGDFSVLANAAPGTTAAAQGSLGFAVSEQGV
GNRLSLTDDALARNLADVQLRGGLPPSGLPGSRDFTVEMETGTGKTYVYLRTIFELNRRY
GFTKFVIVVPSIAIKEGVHKTLAITEDHFRALYAGVPYDYFLYDSAKLGQVRHFAASAAI
QIMVMTVAAINKKEINNLYKDSEKTGGEKPIDLIRATRPIVIVDEPQSVDGGLEGRGREA
LAAMAPLCTLRYSATHVDRHHMVYRLDAVDAYERKLVKQIEIASAIVEDAHNKPYVRLVG
VSNRRGAISARVELDVATAAGVKRQIVSATDGDDLERLTKRALYAGLRIGEVHAVKGAEY
VELRHPEGEAFLSLGEAFGDIDTLAVQREMIRRTIREHLDKELRLAERGVKVLSLFFVDS
VERYRRYDENGMPVKGDYALIFEEEYARAARVPAYRALFDGVDVALEVERAHNGYFSIDR
KGGWTDTSESSAAARENAERAYGLIMREKEALLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIQTERERRQTLGRGLRLAVDQDGERVRDAGVNTLTVIATERYESFAENLQKEIEA
DTGIRFGIVEEHQFAALPVQEDGGPAHALGIELSRVLWNHLHEQGYVDAQGKVLDRLKDA
LRRSALVLPDAFEPLRAPIVATLRKLSGRFAVRNADERRAIALRRDASGKAVVFGEDFRA
LWDRIRHRTVYRVEFDNAKLVRDCTAALRDAPDIARARLQWRKAEIDIGKAGIEAIEVAG
AGTVLLDEGELPLPDLLTELQDRTQLTRRSLATILADSGRLDDFRVNPQQFIAVAADAIN
RCKRLALVAGIAYRKLGERHVHALESFESEALTGYLRNLRPDARKSIHEAVVCETDAERA
FADALEAHDGVKLYAKLPAWFRVQTPLGSYHPDWAVLAEQDGGERLYFVVDTPNADGHVP
SEHERAKLACGEAHFRALVDGDGAARFVRVTQADALFEPAAPTAGAGR
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcatttcgaagcggatctcgactaccagcgcgaggcgatcgacgccgtctgc
gacctgtttcgcgggcaggaatcgtatcgcggcgacttcagcgtgctcgcgaacgccgcg
cccggcacgacggccgccgcgcaaggctcgctcggcttcgcggtatcggagcaaggcgtc
ggcaaccggctgtcgctgaccgacgacgcgctcgcgcgcaatctcgccgacgtgcagttg
cgcggcgggctgccgccgtccggcctgcccggctcgcgcgacttcaccgtcgagatggag
accggcaccggcaagacctacgtgtacctgcgcacgatcttcgagctgaaccgccgctac
ggcttcacgaaattcgtgatcgtcgtgccgtcgatcgcgatcaaggaaggcgtgcacaag
acgctcgcgatcaccgaggatcacttccgcgcgctgtacgcgggcgtgccgtacgactac
ttcctgtacgactccgcgaagctcggccaggtgcgtcacttcgcggcgagcgcggcaatc
cagatcatggtgatgacggtcgccgcgatcaacaagaaagagatcaacaacctctacaag
gacagcgagaagaccggcggcgagaagcccatcgacctgatccgcgcgacgcggccgatc
gtgatcgtcgacgagccgcaaagcgtcgacggcggcctcgaagggcgcgggcgcgaagcg
ctcgccgcgatggcgccgctctgcacgctgcgctattcggccacgcacgtcgaccgccat
cacatggtgtaccggctcgatgcggtcgacgcgtacgagcgcaagctcgtcaagcagatc
gagatcgcgtcggcgatcgtcgaggatgcgcacaacaagccgtacgtgcggctcgtcggc
gtgtcgaaccggcgcggcgcgatcagcgcgcgcgtcgagctcgacgtcgcgacggcggcc
ggcgtgaagcgccagatcgtgtcggcgaccgacggcgacgatctcgaacgcctgaccaag
cgcgcgctgtacgcggggctgcggatcggcgaagtgcatgcggtcaagggcgccgaatac
gtggagctgcgccatccggaaggcgaggcgttcctgtcgctcggcgaggcgttcggcgac
atcgacacgctggccgtacagcgcgagatgatccgccgcacgatccgcgagcatctcgac
aaggagctgcgcctcgccgagcgcggcgtgaaggtgttgtcgttgttcttcgtcgactcg
gtcgaacgctatcgccgctatgacgagaacggcatgccggtgaagggcgactacgcgctg
atcttcgaagaggaatatgcgcgcgcggcgcgcgtgccggcctaccgtgcgctgttcgac
ggcgtcgacgtcgcgctggaagtcgagcgtgcgcacaacggctacttctcgatcgaccgc
aagggcggctggaccgacacgagcgaaagcagcgcggcggcccgggagaacgcggagcgt
gcttacggcctcatcatgcgcgagaaggaagcgctgctgtcgttcgacacgccgctgaag
ttcatcttctcgcactcggcgctgaaggaaggctgggacaacccgaacgtgttccagatc
tgcacgctgcgcgacatccagaccgaacgcgagcgccgccagacgctcggccgcgggctg
cgcctcgcggtcgaccaggacggcgaacgcgtgcgcgacgcgggcgtgaacacgctcacc
gtgatcgcgaccgagcgctacgagtcgttcgccgagaacctgcagaaggaaatcgaggcc
gatacgggcattcgtttcgggatcgtcgaggaacaccagttcgcggcgctgccggtgcag
gaagacggcggtcccgcgcatgcgctcggcatcgagctgtcgcgcgtgctgtggaaccat
ctgcacgagcagggctacgtcgacgcgcagggcaaggtgctcgaccggctgaaggatgcg
ctgcgccggagcgcgctcgtgctgccggacgcgttcgagccgctgcgcgcgccgatcgtc
gcgacgctgcgcaagctgtcgggccgcttcgcggtgcgcaatgccgacgagcgccgcgcg
atcgcgttgcggcgcgatgcatcgggcaaggccgtcgtgttcggcgaggatttccgcgcg
ttgtgggaccgcatccgtcatcgcaccgtgtaccgcgtcgagttcgacaacgcgaagctg
gtgcgcgactgcacggccgcgttgcgcgacgcgccggacatcgcacgggcgcggctgcag
tggcgcaaggccgagatcgacatcggcaaggccggcatcgaggcgatcgaggtggccggc
gccggcacggtgctgctcgacgaaggcgagttgccgctgcccgacctgctcaccgagctg
caggaccgcacgcagctcacgcgccgttcgcttgcgacgatcctcgccgacagcggccgg
ctcgacgatttccgcgtgaatccgcagcagttcatcgcggtcgcggccgatgcgatcaac
cgctgcaagcggctcgcgctcgtcgcgggcatcgcgtaccgcaagctcggcgagcgccac
gtgcatgcgctcgaatcgttcgagagcgaagcgctgaccggctacctgcgcaacctgcgg
ccggacgcgcgcaagtcgatccacgaagcggtcgtgtgcgagacggacgccgagcgcgcg
ttcgccgatgcgctcgaagcgcacgacggcgtgaagctgtacgcgaagctgccggcgtgg
ttccgcgtgcagacgccgctcggcagctatcaccccgactgggccgtgctcgcggaacag
gacggcggcgagcggctgtacttcgtcgtcgatacgccgaatgccgatggccacgtgccg
agcgagcacgaacgcgcgaagctcgcgtgcggcgaagcgcatttccgcgcgctggtcgat
ggcgacggcgcggcgcgcttcgtgcgggtcacgcaggccgatgcgttgttcgagcctgcg
gcgccgacggcgggcgcggggcgctga

DBGET integrated database retrieval system