KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0176Help
Entry
Bcen2424_0176     CDS       T00415                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bcen2424_0176
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcen2424_0176
   00650 Butanoate metabolism
    Bcen2424_0176
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen2424_0176
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcen2424_0176
   00310 Lysine degradation
    Bcen2424_0176
   00360 Phenylalanine metabolism
    Bcen2424_0176
   00380 Tryptophan metabolism
    Bcen2424_0176
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcen2424_0176
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcen2424_0176
   00281 Geraniol degradation
    Bcen2424_0176
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen2424_0176
   00627 Aminobenzoate degradation
    Bcen2424_0176
   00930 Caprolactam degradation
    Bcen2424_0176
Enzymes [BR:bch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bcen2424_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:195174..195920
Genome map
AA seq 248 aa AA seqDB search
MKCYVTAIHENGIATLTLADPERRNVLSEVLCEQLIDAVAAAHADQDVRALVIAAQGPAF
CAGAHRDDLRAAAEGDARVIGKVYQTFMDVANSPLPTIAAINGPAVGAGMNLALACDLRI
ASSSARFDTRFIGIGLHPGGGHGWMLVRAVGWQNAASLLLLGAAVNAAEAMRMGLVSACV
ADDGLADAVASACRRIRSAPRELLLRTKASLRHAASASHAAAFERETAEQKWSMQQPEFL
SMLGSAQK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgctatgtaaccgcaatccacgagaacgggatcgccacgctcacgcttgccgat
cccgagcgtcgtaatgtcctttccgaggtgctttgcgaacagttgatcgatgcggtcgcg
gcggctcatgccgaccaggatgtccgcgcgctggtgattgctgcgcagggtccagcgttc
tgcgcgggcgcgcatcgcgacgatctgcgcgccgccgccgaaggtgatgcacgcgtgatc
ggcaaggtgtatcaaaccttcatggacgtcgcgaattcgccgctgcccaccatcgcagcg
atcaacgggccggcagtcggcgccggcatgaacctggcgctcgcatgcgacttgcgcatt
gcgtcgtcgtccgcccgcttcgatacgcgctttatcggtatcggcttgcaccccggcggt
gggcatggctggatgcttgtgcgtgcagtgggatggcaaaacgcagccagtctgctgctg
ctcggcgcagccgtgaatgcggcggaagcgatgcgcatgggtctggtgagcgcctgcgtg
gccgatgacggcctggccgacgccgtcgcaagcgcctgccgacgcattcgtagcgcaccg
cgtgagctgctgctgcgaaccaaggcgagcctgcgtcatgcggcgagcgcttcgcatgcg
gccgctttcgaacgggaaacggccgaacagaagtggtcaatgcagcaacccgagtttctc
tcgatgctggggagcgcgcaaaaatga

DBGET integrated database retrieval system