KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0383Help
Entry
Bcen2424_0383     CDS       T00415                                 

Definition
putative sulfite oxidase subunit YedY
Orthology
K07147  
sulfoxide reductase catalytic subunit YedY [EC:1.8.-.-]
Organism
bch  Burkholderia cenocepacia HI2424
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:428994..429989
Genome map
AA seq 331 aa AA seqDB search
MWIKRPLRNVLTGADIASSEITPRAVFENRRRVLQAAGLAAAGGLFGTSGAALAAYASPD
SRAAKLAAKTNPKFVAIDKVTPFKDITSYNNFYEFGTDKSDPAQNAGTLRPRPWRVSVEG
EVQHPKVFDLDELLKLAPLEERVYRLRCVEGWSMVIPWIGVPLSELIKRVQPTGNAKYVQ
FITLADPSQMPGLSTPVLDWPYSEGLRMDEAMNPLTLLTMGVYGQVLPNQNGAPVRIVVP
WKYGFKSAKSLVKIRFVDKQPKTSWNTYAANEYGFYSNVNPNVDHPRWSQATERRIGEDG
FFTPKRKTLMFNGYGDLVASMYQGMDLKKNF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtggatcaaacgccctttgcgtaacgtactgaccggcgcggatatcgcgtcgagcgag
atcacgccgcgcgcggtattcgagaaccggcggcgcgtgttgcaggccgccggcctcgcg
gcggcgggtggcctgttcggcaccagcggcgcggcgctcgccgcgtatgcgtcgcccgac
tcgcgagcggcgaagctcgcggcaaagaccaatccgaaattcgtcgccatcgacaaggtg
acgccgttcaaggacatcacgtcctacaacaacttctacgaattcggcaccgacaagagc
gacccggcgcagaacgccggcacgctgcggccgcgcccgtggcgggtgagcgtcgagggc
gaggtgcagcacccgaaggtgttcgatctcgacgagctgctgaagctcgcgccgctcgag
gagcgcgtgtaccggctgcgctgcgtcgagggttggtcgatggtgatcccgtggatcggc
gtgccgctgtccgagctgatcaagcgcgtgcagccgaccggcaacgcgaaatacgtgcag
ttcatcacgctggccgatccgtcgcagatgccgggcctgtcgacgcccgtgctcgactgg
ccgtattcggaagggctgcggatggacgaggcgatgaatccgctgacgctgctgacgatg
ggcgtctacgggcaggtgctgccgaaccagaatggcgcgccggtgcggatcgtcgtgccg
tggaagtacggcttcaagagtgcgaagtcgctcgtgaagatccgcttcgtcgacaagcag
ccgaagacgagctggaacacgtatgcggcgaacgagtacggcttttactcgaacgtgaac
ccgaacgtcgatcatccgcgctggagccaggccaccgagcggcgcatcggcgaggacggc
ttcttcacgccgaagcgcaagacgctgatgttcaacggctacggcgatctggtcgcgtcg
atgtatcagggcatggacctgaagaagaacttctga

DBGET integrated database retrieval system