KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0531Help
Entry
Bcen2424_0531     CDS       T00415                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01130  Biosynthesis of antibiotics
bch01230  Biosynthesis of amino acids
Module
bch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcen2424_0531
Enzymes [BR:bch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bcen2424_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABK07285
JGI: Bcen24240531
UniProt: A0K458
Position
1:complement(591397..592182)
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEIAAALRSTPLEALKLEASARDLRDFVGALRAKHAAGNAAVIAEIK
KASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGGVRYLEEARAACTLPVLRK
DFIVDAYQIVEARAMGADAILLIAAALDTPLMQDLEAYAHSLGLAVLVEVHDRHEMEQAL
TLKTPLLGINNRNLRTFETSIQTTLDMLDMIPADRIVVTESGILSRTDVDTMRAANVNTF
LVGEAFMRAEQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgaatcatcgccgtcaagcgcgaagaaatcgcggcggccctg
cgcagcacgccgctcgaggcactgaaactggaagcctcggcgcgcgacctgcgcgacttc
gtcggcgcgctgcgcgcgaagcacgcggccggcaacgccgccgtgatcgccgaaatcaag
aaggccagcccgtcgaaaggcgtgctgcgcgagcatttcgtgccggccgacatcgcgcgc
tcgtatgcggcgcacggcgccgcgtgcctgtcggtgctgaccgacgagcagttcttccag
ggcggcgtccgctatctcgaggaagcgcgcgcggcctgcacgctgccggtgctgcgcaag
gacttcatcgtcgacgcgtaccagatcgtcgaagcccgcgcgatgggcgccgatgcgatc
ctgctgatcgccgccgcactcgacacgccgctgatgcaggatctcgaagcgtatgcgcac
tcgctcggcctcgcggtgctggtcgaagtgcacgaccgccacgagatggaacaggcgctg
acgctgaagacgccgctgctcggcatcaacaaccgcaacctgcgcacgttcgagacgtcg
atccagaccacgctcgacatgctcgacatgattccggcggatcgcatcgtcgtgaccgaa
tcgggcatcctgtcgcgcaccgacgtcgacacgatgcgcgcggcgaacgtgaacacgttc
ctcgtcggcgaggcgttcatgcgcgccgagcagccgggcgaggaactcgcacggatgttc
ttctga

DBGET integrated database retrieval system