KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0867Help
Entry
Bcen2424_0867     CDS       T00415                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00240  Pyrimidine metabolism
bch00250  Alanine, aspartate and glutamate metabolism
bch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bcen2424_0867
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcen2424_0867
Enzymes [BR:bch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bcen2424_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABK07620
JGI: Bcen24240867
UniProt: A0K543
Position
1:970456..971487
Genome map
AA seq 343 aa AA seqDB search
MTTDTTGRTGNPAAAASPDRFRYGFLKGNPQLTKNGELKHLLSIEGLPRSIVNHILDTAE
QFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAATRLSADVLNLNINASSTSKG
ESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMY
TIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVK
VFHNLDEGLKGVDVIIMLRLQNERMSGALLPSAQEYFKTWGLTPERLALAAPDAIVMHPG
PMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNSD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacaccactggccgcaccggcaatcccgcggcggccgcgagccccgaccgg
tttcgctacggtttcctgaagggcaacccgcagctcacgaaaaacggcgagctgaagcac
ctgctgtcgatcgagggcctgccgcgctcgatcgtcaatcacatcctcgataccgccgag
cagttcgtcagcgtgacggaccgtgaagtgaaaaaggtgccgctgctgcgcggcaagtcc
gtgttcaatctgttcttcgagaactcgacgcgcacccgcacgaccttcgagattgccgcg
acgcgcctgtcggccgacgtgctgaacctgaacatcaacgcgtcgtcgacgagcaagggc
gaatcgctgctcgacacgatcaacaacctgtcggcgatgcatgccgacctgttcgtcgtg
cgccacgcgtcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcac
gtgatcaacgccggcgacggccgtcatgcgcacccgacgcagggcctgctcgacatgtac
acgatccgtcactacaagcgcgacttcacgaagctgcgcgtggcgatcgtcggcgacatc
ctgcattcgcgcgtcgcgcgctccgacatccacgcgctcaccacgctcggcgtgccggaa
gtgcgagcgatcggcccgcgcacgctgctgccgggcggtctcgagcagatgggcgtgaag
gtgttccacaacctcgacgaggggctgaagggcgtcgacgtgatcatcatgctgcgtctg
cagaacgaacggatgagcggcgcgctgctgccgtccgcgcaggagtacttcaagacgtgg
ggcctgacgcccgagcgcctcgcgctcgccgcgcccgacgcgatcgtgatgcatccgggg
ccgatgaaccgcggcgtcgaaatcgattcgcaggtcgccgacggtccgcaatcggtgatc
ctcaaccaggtcacgttcggcatcgccgtgcggatggcggtgatgggcatcgtcgccggc
aacagcgactga

DBGET integrated database retrieval system