KEGG   Burkholderia cenocepacia HI2424: Bcen2424_0999Help
Entry
Bcen2424_0999     CDS       T00415                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00230  Purine metabolism
bch01100  Metabolic pathways
Module
bch_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bcen2424_0999
Enzymes [BR:bch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Bcen2424_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 AAA_18 RsgA_GTPase ABC_tran AAA_16 AAA_22 AAA_29 Septin AAA_23 DUF3987 AAA_25 Viral_helicase1 cobW Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ABK07752
JGI: Bcen24240999
Position
1:1105742..1106425
Genome map
AA seq 227 aa AA seqDB search
MTDSTRDGHASHSLHGGVYPGNLFMVVAPSGAGKSTLVNALLSKDSDICLSISYTTRKPR
PGEQDGQHYHFTTVEDFRARHAAHEFLESAEVHGNYYGTSRVWIEEQMRNGHDVLLEIDW
QGALQVKKQFRNAVGIFILPPSLDALEERLKKRGQDEPNVITRRLLAAGSEIAHASEAEY
VVINENFERALAELECIVAATRLRFASQYARHTELFIDLGVHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattccacccgcgacggccacgcgtcgcattcgctgcatggcggcgtctatccc
ggtaacctgttcatggtcgtcgcgccgtcgggcgccggcaagtcgacgctcgtgaatgcg
ctgctgtcgaaggacagcgacatctgcctgtcgatctcgtacacgacgcgcaagccgcgc
ccgggcgagcaggacggccagcactaccacttcacgaccgtcgaggatttccgcgcacgt
cacgcggcgcacgaattcctcgagagcgcggaagtgcacggcaactactacggcacgtcg
cgcgtctggatcgaagagcagatgaggaacggccacgacgtgctgctcgaaatcgactgg
cagggtgcgttgcaggtgaagaagcagttccgcaacgcggtcggcatcttcatcctgccg
ccgtcgctcgatgcgctcgaagagcgcctgaagaagcgcggccaggacgaaccgaacgtg
atcacgcggcgcctgctggccgccggcagcgagatcgcgcacgcgtcggaagcggaatac
gtggtgatcaacgagaatttcgagcgtgcgctcgcggaactcgaatgcatcgtcgcggcg
acgcgcctgcgttttgcttcgcagtacgcgcgacacacggagctgttcatcgacctcggc
gtccatctgccccacgcggaatga

DBGET integrated database retrieval system