KEGG   Burkholderia cenocepacia HI2424: Bcen2424_1216Help
Entry
Bcen2424_1216     CDS       T00415                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bch03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1345934..1348252
Genome map
AA seq 772 aa AA seqDB search
MTASDDMLEFTGGLVARLPEPADFGIALAEGFARRIGDLARRAGAPSASARWAARAAFAT
SRATASGHVCVALGALAQRYEAPLDEVRAALAASGVVAFGTLARGDERPLIVDRLDHLYL
SRYFDYERRLADALVAQAGVAAPDEGLSPDRLRDSLARYFGPATGEVDWQRVAAIVALTG
RVTIVSGGPGTGKTTTVVGVLACLLDAHPGLRIALAAPTGKAAQRMQEALHARAGDLPPE
LAARLPDTSYTLHRLLGGGGAAGFRHHRDNPLPYDLIVVDEASMIDVALAAHLLDALAPG
ARLVLLGDKDQLAAVEAGAVFAELSARPAFTAAARARIAQALGIDEATFVAALPAPDEAA
PVAVPAAQPVSASARAPASPSASAPVSRKSALRSSKVDARQASLFDDEPQDDEVSSTDIA
PPPRAESALTADAGAPDGKAPAWIEADELAWLDTVELPPFDAGDAALASMTAPASPLAGE
AAAAAASTGTPAAAPLADCVVWLERNYRFGLDSPIGRLSLAIRRGDVQAALEALPADDSA
AASFHDDAGDTLASSTVERLARRFGVYLDALRDALAAPAPDPLPLFDALNRFRILCATRS
GSRGAEHVNALVAAHVRHAARVPLAVGAHWFTGRPIMITRNDYALGLFNGDIGIALPDAH
GVLRVWFRRADGTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFGRVLTREL
VYTAVTRARTRVQVIGPRRVLAQAVATRTQRDSGLAARVDEALARRRTEVSR
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccgacgacatgctcgaattcaccggcggtctcgtcgcgcggctgcccgag
ccggccgatttcggcattgcgctcgcggaaggcttcgcgcgccgcatcggtgacctcgcg
cgacgtgccggtgcgccgtccgcgtcggcacgctgggcggcgcgtgccgcgttcgcgacg
agccgcgcgaccgcgagcggccacgtgtgcgttgcgctcggcgcgcttgcacagcgttac
gaagcgccgctcgacgaggtccgcgcggcgcttgccgcgagcggcgtggtcgcgttcggc
acgctcgcgcgcggcgacgaacggccgctgatcgtcgaccggctcgatcacctgtacctg
tcgcgctatttcgattacgaacggcggctcgccgatgcgctcgtcgcgcaggccggcgtc
gccgcgccggacgaaggactgtcgcccgaccggttgcgcgacagtctcgcccgttacttc
gggccggccaccggtgaagtcgactggcagcgcgtcgcggcgatcgtcgcgctgacgggc
cgcgtgacgatcgtcagcggcgggccgggcacgggcaagacgacgaccgtcgtcggcgtg
ctggcctgtctgctcgacgcgcacccggggctgcgcatcgcgctggccgcaccgaccggc
aaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggcgatctgccgcccgag
ctcgcggcgcgcctgcccgacacgtcgtacacgctgcatcggctgctgggcggcggcggg
gcagccggctttcggcatcatcgcgacaatccgttgccgtacgacctgatcgtcgtcgac
gaggcgtcgatgatcgacgtcgcgctcgccgcgcatctgctcgacgcgctcgcgccgggc
gcgcggctcgtgttgctgggcgacaaggaccaactggcggcggtcgaggccggcgccgta
ttcgcggagctgagcgcgcggccggcgttcaccgccgcggcgcgcgcgcgcatcgcgcag
gcgctgggcatcgacgaggcgacgttcgtcgcggcgttgccggcgccggacgaggcggcg
ccggtagcggttccggccgcgcagccggtttccgcttccgcacgggctccggcgtcgcca
tcggcatccgcgcctgtttcgcgcaaatcggcgcttcggtcgtcgaaagtcgatgcgcga
caggcgtcgctgttcgacgacgaaccgcaggatgacgaagtgtcgtcgaccgacatcgcg
ccgcccccgcgcgccgagtcggcactgaccgccgatgccggcgcaccagacggcaaggca
ccggcctggatcgaggccgacgaactcgcgtggctcgacaccgtcgagctgccgccattc
gacgcaggcgatgcggcgcttgcatcgatgacggcgcccgcatcgccattggccggcgaa
gcggcagccgcagccgcgtccaccggcacgcccgccgcggcgccgctcgcggactgcgtc
gtatggctcgaacgcaattaccgcttcggtctcgattcgccgatcgggcggctgtcgctc
gcgatccgccgcggcgacgtgcaggcggcgctcgaagcgctgcccgccgacgattcggcc
gccgcatcgtttcacgacgatgcgggcgacacgctggcgtcgtcgacggtcgagcggctc
gcccggcgtttcggcgtctaccttgacgcattgcgcgatgcgctggccgcgccggcgccc
gatccgctgccgctgttcgacgcgctcaaccggttccggatcctgtgcgcgacccgcagc
ggctcgcgcggcgcggaacacgtcaatgcgctggtggccgcgcacgtgcggcatgcggcg
cgcgtgccgctcgcggtcggcgcgcactggttcaccgggcggccgatcatgatcacacgc
aacgactacgcgctggggctgttcaacggtgatatcggcatcgcgctgccagacgcgcat
ggcgtgctacgcgtgtggttccggcgcgcggacggcaccgcgcgcgcggtgtcgccggct
gcgctgccgccgcacgaaacggctttcgcgctgacggtgcacaagtcgcagggctcggaa
ttcgacgaggcggcgctcgtgctgcccgcgtcgttcggccgggtgctgacgcgcgagctg
gtctatacggccgtcacgcgcgcccgcacgcgcgtgcaggtgatcgggccgcggcgcgtg
ctggcgcaggcggtcgcgacacgcacgcagcgcgattcggggctcgcggcccgcgtcgac
gaggcgcttgcccggcgccgcacggaggtttcgcgatga

DBGET integrated database retrieval system