KEGG   Burkholderia cenocepacia HI2424: Bcen2424_1216Help
Entry
Bcen2424_1216     CDS       T00415                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcen2424_1216
Enzymes [BR:bch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bcen2424_1216
DNA repair and recombination proteins [BR:bch03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Bcen2424_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD UvrD-helicase DUF2075 MukB AAA_22 ATPase
Motif
Other DBs
NCBI-ProteinID: ABK07968
JGI: Bcen24241216
Position
1:1345934..1348252
Genome map
AA seq 772 aa AA seqDB search
MTASDDMLEFTGGLVARLPEPADFGIALAEGFARRIGDLARRAGAPSASARWAARAAFAT
SRATASGHVCVALGALAQRYEAPLDEVRAALAASGVVAFGTLARGDERPLIVDRLDHLYL
SRYFDYERRLADALVAQAGVAAPDEGLSPDRLRDSLARYFGPATGEVDWQRVAAIVALTG
RVTIVSGGPGTGKTTTVVGVLACLLDAHPGLRIALAAPTGKAAQRMQEALHARAGDLPPE
LAARLPDTSYTLHRLLGGGGAAGFRHHRDNPLPYDLIVVDEASMIDVALAAHLLDALAPG
ARLVLLGDKDQLAAVEAGAVFAELSARPAFTAAARARIAQALGIDEATFVAALPAPDEAA
PVAVPAAQPVSASARAPASPSASAPVSRKSALRSSKVDARQASLFDDEPQDDEVSSTDIA
PPPRAESALTADAGAPDGKAPAWIEADELAWLDTVELPPFDAGDAALASMTAPASPLAGE
AAAAAASTGTPAAAPLADCVVWLERNYRFGLDSPIGRLSLAIRRGDVQAALEALPADDSA
AASFHDDAGDTLASSTVERLARRFGVYLDALRDALAAPAPDPLPLFDALNRFRILCATRS
GSRGAEHVNALVAAHVRHAARVPLAVGAHWFTGRPIMITRNDYALGLFNGDIGIALPDAH
GVLRVWFRRADGTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFGRVLTREL
VYTAVTRARTRVQVIGPRRVLAQAVATRTQRDSGLAARVDEALARRRTEVSR
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccgacgacatgctcgaattcaccggcggtctcgtcgcgcggctgcccgag
ccggccgatttcggcattgcgctcgcggaaggcttcgcgcgccgcatcggtgacctcgcg
cgacgtgccggtgcgccgtccgcgtcggcacgctgggcggcgcgtgccgcgttcgcgacg
agccgcgcgaccgcgagcggccacgtgtgcgttgcgctcggcgcgcttgcacagcgttac
gaagcgccgctcgacgaggtccgcgcggcgcttgccgcgagcggcgtggtcgcgttcggc
acgctcgcgcgcggcgacgaacggccgctgatcgtcgaccggctcgatcacctgtacctg
tcgcgctatttcgattacgaacggcggctcgccgatgcgctcgtcgcgcaggccggcgtc
gccgcgccggacgaaggactgtcgcccgaccggttgcgcgacagtctcgcccgttacttc
gggccggccaccggtgaagtcgactggcagcgcgtcgcggcgatcgtcgcgctgacgggc
cgcgtgacgatcgtcagcggcgggccgggcacgggcaagacgacgaccgtcgtcggcgtg
ctggcctgtctgctcgacgcgcacccggggctgcgcatcgcgctggccgcaccgaccggc
aaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggcgatctgccgcccgag
ctcgcggcgcgcctgcccgacacgtcgtacacgctgcatcggctgctgggcggcggcggg
gcagccggctttcggcatcatcgcgacaatccgttgccgtacgacctgatcgtcgtcgac
gaggcgtcgatgatcgacgtcgcgctcgccgcgcatctgctcgacgcgctcgcgccgggc
gcgcggctcgtgttgctgggcgacaaggaccaactggcggcggtcgaggccggcgccgta
ttcgcggagctgagcgcgcggccggcgttcaccgccgcggcgcgcgcgcgcatcgcgcag
gcgctgggcatcgacgaggcgacgttcgtcgcggcgttgccggcgccggacgaggcggcg
ccggtagcggttccggccgcgcagccggtttccgcttccgcacgggctccggcgtcgcca
tcggcatccgcgcctgtttcgcgcaaatcggcgcttcggtcgtcgaaagtcgatgcgcga
caggcgtcgctgttcgacgacgaaccgcaggatgacgaagtgtcgtcgaccgacatcgcg
ccgcccccgcgcgccgagtcggcactgaccgccgatgccggcgcaccagacggcaaggca
ccggcctggatcgaggccgacgaactcgcgtggctcgacaccgtcgagctgccgccattc
gacgcaggcgatgcggcgcttgcatcgatgacggcgcccgcatcgccattggccggcgaa
gcggcagccgcagccgcgtccaccggcacgcccgccgcggcgccgctcgcggactgcgtc
gtatggctcgaacgcaattaccgcttcggtctcgattcgccgatcgggcggctgtcgctc
gcgatccgccgcggcgacgtgcaggcggcgctcgaagcgctgcccgccgacgattcggcc
gccgcatcgtttcacgacgatgcgggcgacacgctggcgtcgtcgacggtcgagcggctc
gcccggcgtttcggcgtctaccttgacgcattgcgcgatgcgctggccgcgccggcgccc
gatccgctgccgctgttcgacgcgctcaaccggttccggatcctgtgcgcgacccgcagc
ggctcgcgcggcgcggaacacgtcaatgcgctggtggccgcgcacgtgcggcatgcggcg
cgcgtgccgctcgcggtcggcgcgcactggttcaccgggcggccgatcatgatcacacgc
aacgactacgcgctggggctgttcaacggtgatatcggcatcgcgctgccagacgcgcat
ggcgtgctacgcgtgtggttccggcgcgcggacggcaccgcgcgcgcggtgtcgccggct
gcgctgccgccgcacgaaacggctttcgcgctgacggtgcacaagtcgcagggctcggaa
ttcgacgaggcggcgctcgtgctgcccgcgtcgttcggccgggtgctgacgcgcgagctg
gtctatacggccgtcacgcgcgcccgcacgcgcgtgcaggtgatcgggccgcggcgcgtg
ctggcgcaggcggtcgcgacacgcacgcagcgcgattcggggctcgcggcccgcgtcgac
gaggcgcttgcccggcgccgcacggaggtttcgcgatga

DBGET integrated database retrieval system