KEGG   Burkholderia cenocepacia HI2424: Bcen2424_1380Help
Entry
Bcen2424_1380     CDS       T00415                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcen2424_1380
Enzymes [BR:bch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Bcen2424_1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1520348..1521577
Genome map
AA seq 409 aa AA seqDB search
MARAMTKRRATQPARRVGATLALAVAVTCAAAGMATRAHAAAAGAADAASTGCSAAWPRW
DAFKRDFISADGRVIDVGSADSRTVSEGQAYGLFFALVANDRRMFDTILAWTENNLAQGD
LSAHLPAWLWGRAPDGAWRVLDANPASDADLWIAYALVEAGRLWHERSYTARGALLAKRV
LDAETATVPGLGLTLLPGPTGFKLANGQWRVNPSYSPPQVIRALGARLPDDRRWAALASS
TARVLLDTAPKGFSPDWALYRAGNGFGPDPQTHAESAYNAIRVYLWAGMLDRADPLAAPL
LAKFAPFADHIAAHGAPPEKVDTTTGVAGPNDGNGGFSAAAVPFLDARGQHALADAQAAR
VDTLARQSAPGYYTSVLTLFGLGWRDGRYRFGADGTLDTRWGGRSCAAR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggcaatgacgaagcgacgggcaacgcagccggcgcggcgtgtcggcgcgacg
ctcgcgctggcggtcgcggtgacgtgcgcggcggccggcatggccacgcgcgcgcacgcg
gcggcggccggtgcagccgatgcggcgagcacgggatgcagcgcggcgtggccgcgctgg
gacgcgttcaagcgtgatttcatctcggccgacggccgggtgatcgacgtcggctcggcc
gattcgcgcacggtatcggaggggcaggcgtatggacttttcttcgcgctggtcgcgaac
gaccggcgcatgttcgacacgatcctcgcatggaccgagaacaacctcgcgcagggcgac
ctgagcgcgcacctgccggcgtggctgtggggccgtgcgcccgacggcgcgtggcgcgtg
ctcgacgcgaacccggcgtcggacgccgacctgtggatcgcgtatgcgctcgtcgaggcc
gggcggctgtggcacgagcgcagctatacggcgcgcggcgcgctgctcgcgaagcgcgtg
ctcgacgccgagacggcgaccgtgccgggcctcggcctcacgctgctgccgggcccgacc
gggttcaagctggccaacggccaatggcgcgtgaatccgagctattcgccgccgcaggtg
attcgcgcgctcggcgcacgactgcccgacgaccgtcgctgggccgcgctggcgtccagc
accgctcgcgtgctgctcgacaccgcgccgaagggcttttcgcccgactgggcgctgtat
cgcgcgggcaacggtttcgggcccgatccgcagacccatgcggaaagcgcgtacaacgcg
atccgcgtgtacctgtgggccggcatgctggaccgcgccgatccgcttgccgcgccgctg
ctcgcgaagttcgcgccgttcgccgaccatatcgccgcgcacggcgcgccgccggagaag
gtcgatacgacgacgggcgtcgcggggccgaacgacggcaacggcggcttctccgcggcc
gccgtgccgttcctcgacgcacgcggccagcacgcgctcgcggatgcccaggcggcccgc
gtcgatacgctcgcgcgccagtcggcgcccggctattacacgagcgtgctgacgctgttc
ggcctcggctggcgcgatggccgctaccggttcggggcggacggcacgctcgacacccgc
tggggaggccgttcgtgcgccgcccgctga

DBGET integrated database retrieval system