KEGG   Burkholderia cenocepacia HI2424: Bcen2424_1658Help
Entry
Bcen2424_1658     CDS       T00415                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcen2424_1658
Enzymes [BR:bch01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Bcen2424_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1844942..1846018
Genome map
AA seq 358 aa AA seqDB search
MTDPTTPRARAVFPFAALVAQDALQQALLLVAIDPSLGGVLVSGPRGTAKSTAARGLAEL
LPEGQFVTLPLSASDEQVTGTLDLAHALAENGVRFRPGLLARAHLGVLYVDEVNLLADGL
VDTLLDVAASGVNIVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRARHAAAQRELADRIHAARARLPALDFDDAVHAHVSALC
IDAAVDGLRADLVMLRAARALAALEQADAVTVSHVARVAEAVLRHRRHAGPPPSQQSSQQ
GGERDDRSRSDTPRQPDKRQDDTKADASPSQGDWGYLPPEPAGLRDVKSVVPLPLKKR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgaccacgccccgcgcccgcgcggtttttccgtttgcggcgctcgtcgcg
caggacgcgttgcagcaggcgctgctgcttgtcgcgatcgacccgtcgctcggcggcgtg
ctcgtcagcggcccgcgcggcaccgcgaaatcgacggccgcgcgcggcctggcggagctg
ctgccggaagggcagttcgtcacgctgccgctatcggcgagcgacgagcaggtgacgggc
acgctcgatctcgcgcatgcgctggccgaaaacggcgtgcgttttcgacccggcctgctg
gcgcgcgcgcatctcggcgtgctgtacgtcgacgaagtgaacctgctcgccgacgggctc
gtcgatacgctgctcgacgtcgccgcgagcggcgtgaacatcgtcgagcgcgatggcgtg
tcgcacgcgcacgatgcgcgcttcgtgctggtcggcacgatgaaccccgaggaaggcgag
ttgcggccgcaactgctcgatcgcttcgggctgatggtcgagctggagaactgcttcgac
gccgcccagcgcgagcggatcgtgaaggcgcgactcgcgttcgatctcgatccggatgcg
tttcgcgcgcgtcacgcggcggcccagcgggaactcgcggaccgcattcatgcggcgcgc
gcgcggctgccggcgctcgatttcgacgatgcggtccatgcgcacgtcagcgcactgtgc
atcgacgcggccgtcgacgggttgcgggccgatctcgtgatgctgcgcgccgcgcgtgcg
ctggccgcactggaacaggccgacgcggtgacggtgtcgcatgtggcgcgcgtggccgaa
gccgtgctgcggcaccggcgccatgcggggccgccgccgtcgcagcagtcgtcgcaacaa
gggggagagcgcgacgatcgttcgcggtcggacacaccacggcagcctgacaagcgacag
gacgacacgaaggccgacgcgtccccatcgcaaggcgactggggctacttgccgcccgaa
ccggccgggctgcgcgacgtgaaaagcgtcgtgccgctgccgctaaaaaaacgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system