KEGG   Burkholderia cenocepacia HI2424: Bcen2424_1822Help
Entry
Bcen2424_1822     CDS       T00415                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bch  Burkholderia cenocepacia HI2424
Brite
Enzymes [BR:bch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bcen2424_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 NodS Methyltransf_31 Methyltransf_11 RrnaAD Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: ABK08573
JGI: Bcen24241822
UniProt: A0K7U6
Position
1:complement(2024167..2025099)
Genome map
AA seq 310 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKSEGRPGERQTAGAVPKAADKPAAVLKPVAVKPAAVRAP
LPGIAAAKPATAPKPTALKPALPKPAAPSIAPAGAFALTSERVRERMVERLRANGVTDAR
VLDAMAAVPRHLFVDPGLATQAYEDSALPIGHQQTISKPSVVARMIELAMAGRTLERVLE
IGTGCGYQAAVLSHVARDVYSIERIKPLYERAKLNLRPLRVPNIRLHYGDGRVGLPSAAP
FDAIVIAAAGLDVPQALLEQLAIGGRLVAPVGAQSGQHQVLTLVERVAHAQWRESRLDRV
FFVPLKSGVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggttcccgctcgcgctcgaagatctcaagcgagcgcca
cgcaagtcggaaggtcggcccggtgaacgccagacggcgggggcggtgccgaaggctgcc
gacaaacccgcggccgtgctgaagccggttgcggtgaagccggccgccgtgcgggcgccg
ctgccgggtatcgccgccgcgaagccggcgaccgcaccgaagcccaccgcgctgaagcct
gcgctgccgaagccggccgcgccgagcatcgcgccggccggcgcgttcgccctcacgtcg
gaacgtgtgcgcgagcggatggtcgaacgcctgcgcgcgaacggcgtgaccgatgcgcgc
gtgctggacgcaatggccgcggtgccgcgccacctgttcgtggatcccgggctcgcgacg
caggcctacgaggattcggcattgccgatcggccatcagcagaccatttcaaagccgtcg
gtcgtcgcgcgcatgatcgagctcgcgatggccggccgcaccctcgagcgcgtgctcgag
atcggcacgggttgcggctatcaggccgccgtgctgagtcacgtggcacgcgacgtgtat
tcgattgaacgcatcaagccgctttacgagcgcgcgaagctgaacctgcggccgctgcgc
gtgccgaacatccgtctgcactacggcgacgggcgtgtcggcttgccgtccgcggccccg
ttcgacgcgatcgtgatcgcggcggcggggctcgacgtgccgcaggcgctgctcgagcag
ctcgcgatcggcgggcggctcgtcgcgccggtcggcgcgcagagcgggcagcaccaggtg
ctcacgctcgtcgagcgcgtcgcgcacgcgcaatggcgagagtcccggcttgatcgcgtt
ttctttgtccctttaaaatccggagtgatttga

DBGET integrated database retrieval system