KEGG   Burkholderia cenocepacia HI2424: Bcen2424_1905Help
Entry
Bcen2424_1905     CDS       T00415                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Bcen2424_1905
Enzymes [BR:bch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Bcen2424_1905
    3.5.1.-  
     Bcen2424_1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2111800..2112432)
Genome map
AA seq 210 aa AA seqDB search
MKRTDDVLLVIDVQYDFMPGGALAVPDGDAVVPVINALAQCFDQVVLTQDWHPREHVSFA
ANHPGREPFSTLALPYGEQVLWPVHCVQDTDGAALHRDLDIPHARLVIRKGGDAQVDSYS
AFVEADRTTRTGLAGYLRELGAKRVWCCGLATDYCVAWSALDARAAGFEAAVINDACRAI
DLNGSLAHAWQQMQAAGVVHATSAGARPAA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaccgacgacgtcctgctcgtgatcgacgtgcaatacgacttcatgccgggc
ggcgcgctcgcggtgcccgacggcgatgcggtcgtgccggtgatcaacgcgctcgcgcaa
tgcttcgaccaggtcgtgctcacgcaggactggcacccgcgcgagcacgtgtcgttcgcg
gcgaaccatccgggccgcgagccgttctcgacgctcgcgctgccgtacggcgagcaggtg
ctgtggcccgtgcactgcgtgcaggacaccgacggcgcggcgctgcatcgcgacctcgac
atcccgcacgcgcggctcgtgatccgcaagggcggcgacgcgcaggtcgacagctattcc
gcgttcgtcgaagccgaccgcacgacacgcacggggctcgcgggctatctgcgcgaactc
ggggcgaagcgcgtgtggtgctgcgggctcgcgaccgactattgcgtcgcgtggtcggcg
ctcgatgcgcgcgcggccggtttcgaagccgcggtgatcaacgatgcgtgccgtgcgatc
gacctgaacgggtcgctcgcgcacgcatggcagcagatgcaggcagcgggcgtcgtgcat
gcgacgtccgcgggcgcgcgcccggcggcgtag

DBGET integrated database retrieval system