KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2013Help
Entry
Bcen2424_2013     CDS       T00415                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00900  Terpenoid backbone biosynthesis
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcen2424_2013
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Bcen2424_2013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABK08764
JGI: Bcen24242013
UniProt: A0K8D7
Position
1:complement(2230199..2231395)
Genome map
AA seq 398 aa AA seqDB search
MQKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDA
ATAAHVDAKLRAAGSKTVVLHGPQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKR
ILLANKEALVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGISKIILTASG
GPFRTREPATLVDVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGDRID
VLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVDQLDLAQIAQLSF
EKPDYARFPCLALALKALEEGGIASAALNAANEVAVEAFLERRIGFMAIAATVDAVLNTL
PNRAPDGLDDVLAADAEARRLAAAIIAKAPAPRVERTV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgtctgacattgctcggttccacgggctcgatcggagacagcacgctcgac
gtggtcgcgcgccatcccgagcgcttctcggtctacgcgctgaccgcgcaccgcaacggc
gacaagctcgtcgagcagtgtctgcgcttcgcgcccgaagtggcggtggtcggcgatgcc
gcaaccgccgcgcacgtcgacgcgaaactgcgcgcggcgggcagcaagacggtcgtgctg
cacgggccgcaggcgctcgtcgacgtgtcgaagagcgacggctgcgacacggtggtcgcg
gcgatcgtcggcgcggccggcctcgcgccgagcctggcggccgcccgcgccggcaagcgg
atcctgctcgcgaacaaggaagcgctcgtgatgtcgggcgcgatcttcatggacgccgtg
cgcgaccatggcgcgatcctgctgccggtcgacagcgagcacaacgcgatcttccagtgc
atgccgcgcgacgcggccgagcacggcgggatctcgaagatcatcctgaccgcgtcgggc
gggccgttccgcacgcgtgaaccggccacgctcgtcgacgtgacgccggacgaggcatgc
aagcacccgaactgggtgatgggccgcaagatctcggtcgattccgcgacgatgatgaac
aagggcctcgaggtgatcgaggcgcactggatcttcgggctgccgggcgaccggatcgat
gtgctgatccatccgcagagcgtgatccattcgctcgtgtcgtaccgcgacggctcggtg
ctcgcgcagctcggcaaccccgacatgcgcacgccgatcgcccacgcgctcgcattcccc
gagcgcgtcgatgcgggcgttgaccagctcgacctcgcgcagatcgcccagctgtcgttc
gagaagcccgattacgcgcgcttcccgtgcctcgcgctcgcgctgaaggcactcgaggaa
ggcggtatcgcgagcgccgcattgaacgcggcgaacgaagtggcggtcgaagcatttctc
gagcgccggatcggcttcatggcgatcgcggcgacggtcgacgccgtgctcaacacgctg
ccgaaccgcgcgcccgacgggctcgacgacgtcctcgcggcggatgccgaggctcgccgc
ctcgccgccgcgatcattgcgaaagcgcctgcgccacgcgtggagcgtactgtctga

DBGET integrated database retrieval system