KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2052Help
Entry
Bcen2424_2052     CDS       T00415                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcen2424_2052
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen2424_2052
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen2424_2052
Enzymes [BR:bch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcen2424_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2276613..2278205
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGMTITGEIKPGYEAILTPDALALVAALHRTFESRRQALLQARVERTKRLDA
GERPDFLAETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYRLNDKVATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELLARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDKAMGGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLRDKPNQIAKQRDDVQVEGRNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAELV
REFAKIELDNVKRAVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcatgacgatcaccggcgaaatcaagccgggt
tacgaagccatcctgacgcccgacgcgctggcactcgtcgcggcgctgcaccgcacgttc
gaatcgcgccgccaggcgctgctgcaggcgcgcgtcgagcgcacgaaacgcctcgacgcg
ggcgagcgccccgatttcctggccgagacgaaggcgatccgcgaaggcgactggaaggtc
gcgccgctgccggccgacctgcaatgccgccgggtcgagatcacggggcccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtaccggctgaacgacaaggtcgcg
acgctgatcgtgcgtccgcgcggctggcacctcgacgagaagcacgtgacggtcgacggc
cagcgcgtgtccggcggcatcttcgatttcgcgctgttcctgttccacaacgcgaaggaa
ctgctcgcgcgcggctcgggcccgtacttctacctgccgaagatggaaagccatctcgag
gcgcgcctgtggaacgacatcttcgtcgccgcgcaggaagcggtcggcgtgccgcgcggc
acgatccgcgcgacggtgctgatcgaaacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgccggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgacttctgcctggccgaccgttcgaagatc
acgatgacggtgccgttcatgcgtgcgtacgcactgctgctgctgaagacctgccacaag
cgcaacgcgccggcgatcggcgggatgagcgcgctgattccgatcaagaacgatccggaa
gcgaacgacaaggcgatgggcggcgtgcgctcggacaagcagcgcgacgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctcgtgccgatcgcgatggaagagttcgtc
aaggtactccgcgacaagccgaaccagatcgcgaagcagcgcgacgacgtgcaggtcgaa
ggcaggaacctgctcgacttccagccggaagcgccgatcaccgaagcgggcctgcgcaac
aacatcaacgtcgggatccactatctcggcgcgtggctcgacggcaacggctgcgtgccg
atccacaacctgatggaagatgcggcgacggccgagatttcccgctcgcaggtgtggcaa
tggatccgctcgccgaagggcgtgctcgacgacggccgcaaggtcacggccgaactcgtg
cgcgaattcgcgaagatcgaactggacaacgtgaagcgcgcggtcggcggcaacacgcaa
ccgtacgagcgcgccgcggcgatcttcgagcagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system