KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2052Help
Entry
Bcen2424_2052     CDS       T00415                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00620  Pyruvate metabolism
bch00630  Glyoxylate and dicarboxylate metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01200  Carbon metabolism
Module
bch_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen2424_2052
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen2424_2052
Enzymes [BR:bch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcen2424_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABK08803
JGI: Bcen24242052
Position
1:2276613..2278205
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGMTITGEIKPGYEAILTPDALALVAALHRTFESRRQALLQARVERTKRLDA
GERPDFLAETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYRLNDKVATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELLARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDKAMGGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLRDKPNQIAKQRDDVQVEGRNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAELV
REFAKIELDNVKRAVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcatgacgatcaccggcgaaatcaagccgggt
tacgaagccatcctgacgcccgacgcgctggcactcgtcgcggcgctgcaccgcacgttc
gaatcgcgccgccaggcgctgctgcaggcgcgcgtcgagcgcacgaaacgcctcgacgcg
ggcgagcgccccgatttcctggccgagacgaaggcgatccgcgaaggcgactggaaggtc
gcgccgctgccggccgacctgcaatgccgccgggtcgagatcacggggcccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtaccggctgaacgacaaggtcgcg
acgctgatcgtgcgtccgcgcggctggcacctcgacgagaagcacgtgacggtcgacggc
cagcgcgtgtccggcggcatcttcgatttcgcgctgttcctgttccacaacgcgaaggaa
ctgctcgcgcgcggctcgggcccgtacttctacctgccgaagatggaaagccatctcgag
gcgcgcctgtggaacgacatcttcgtcgccgcgcaggaagcggtcggcgtgccgcgcggc
acgatccgcgcgacggtgctgatcgaaacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgccggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgacttctgcctggccgaccgttcgaagatc
acgatgacggtgccgttcatgcgtgcgtacgcactgctgctgctgaagacctgccacaag
cgcaacgcgccggcgatcggcgggatgagcgcgctgattccgatcaagaacgatccggaa
gcgaacgacaaggcgatgggcggcgtgcgctcggacaagcagcgcgacgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctcgtgccgatcgcgatggaagagttcgtc
aaggtactccgcgacaagccgaaccagatcgcgaagcagcgcgacgacgtgcaggtcgaa
ggcaggaacctgctcgacttccagccggaagcgccgatcaccgaagcgggcctgcgcaac
aacatcaacgtcgggatccactatctcggcgcgtggctcgacggcaacggctgcgtgccg
atccacaacctgatggaagatgcggcgacggccgagatttcccgctcgcaggtgtggcaa
tggatccgctcgccgaagggcgtgctcgacgacggccgcaaggtcacggccgaactcgtg
cgcgaattcgcgaagatcgaactggacaacgtgaagcgcgcggtcggcggcaacacgcaa
ccgtacgagcgcgccgcggcgatcttcgagcagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system