KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2251Help
Entry
Bcen2424_2251     CDS       T00415                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcen2424_2251 (tpiA)
   01230 Biosynthesis of amino acids
    Bcen2424_2251 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_2251 (tpiA)
   00051 Fructose and mannose metabolism
    Bcen2424_2251 (tpiA)
   00562 Inositol phosphate metabolism
    Bcen2424_2251 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bcen2424_2251 (tpiA)
Enzymes [BR:bch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcen2424_2251 (tpiA)
Exosome [BR:bch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcen2424_2251 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bcen2424_2251 (tpiA)
  Exosomal proteins of melanoma cells
   Bcen2424_2251 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2504955..2505710)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGTVAAETSIGVCVPFPYLAQVQAQLGG
GRVAFGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGESNETVAAKTQRA
LAAGLVPVVCVGETLDERESGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRTRLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgctgctgaacgaagtggtgcagggcgcgggcacggtggcggctgaaacg
tcgatcggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcagcttggcggt
ggccgtgtcgcgttcggtgcacaggacgtgtccgcacacgagcaaggcgcgttcaccggt
gaggtggcggcggcgatggtggcggagttcggcgcgcggtatgcgatcgtcggccactcg
gagcgtcgcgcgtatcacggcgaaagcaacgagacggtcgcggcgaagacgcagcgcgcg
ctcgcggccggcctcgtgccggtcgtgtgtgtcggcgagacgctcgacgagcgcgagtcg
ggtgcgaccgagcaggtcgtcggtgcgcagctcgacgcggtgctggccgtgctgacggct
gacgaggccgcgcgtatcgtcgtcgcgtacgagccggtctgggcgatcggcacgggcaag
agcgcgacgtcggcgcaggcgcaggacgtgcatgcgttcctgcggacgcgtctcgcggca
aagggtgcggcggacgtgtccgtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcaaccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
gaagatttcctggcgatctgccgggccgcgcgttga

DBGET integrated database retrieval system