KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2678Help
Entry
Bcen2424_2678     CDS       T00415                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bcen2424_2678 (glpK)
Enzymes [BR:bch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Bcen2424_2678 (glpK)
Exosome [BR:bch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcen2424_2678 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2967393..2968895
Genome map
AA seq 500 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQPGWVEHDPQEIWSTQAGVA
AEAVTRTGLNGTSIAAIGITNQRETTIVWDRETGQPVYNAIVWQDRRTADFCDSLKKQGL
EAKVRAKTGLPIDSYFSATKIRWILDNVPGARDKARQGKLAFGTVDSWLVWNFTKHELHV
TDVTNASRTMLFNIHTREWDSELLELLDIPRSMLPEVKASSEIYGHTKTTVFASKIPLAG
IAGDQHAALFGQMCTTSGMVKNTYGTGCFLMMNTGDKPIESKNNLVTTIAWQIGDDVQYA
LEGSIFIAGAVVQWLRDGVGLIKTAAEIEALAASVPHTDGVYLVPAFAGLGAPHWNARAR
GSVFGVTRGTSAAHLARAALDAIAYQSLDVLAAMEADSGISIGELRVDGGASANDLLMQF
QADLLGVDAVRPQITETTALGAAYLAGLAIGYWKNLDEVRDQWQLDRRFAPSMPKEQVEQ
RMAGWQRAVRAAKAWADDTQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaccagtacatcctcgcgcttgaccagggcaccacgagttcccgcgcgatgctg
ttcgatcgccagggcaacatcgtatcgatcgcccagaaggaattcgaacagatctacccg
caacccggctgggtcgagcacgacccgcaggaaatctggtcgacgcaagccggcgtcgcc
gcggaagccgtcacgcgcacgggcctgaacggcacgtcgatcgccgcgatcggcatcacg
aaccagcgcgaaacgaccatcgtctgggatcgcgagacgggccagcccgtctacaacgcg
atcgtctggcaggatcgccgcacggccgacttctgcgactcgctgaagaagcagggcctc
gaagcgaaggtgcgcgcgaagaccggcctgccgatcgactcgtacttctccgcgacgaag
atccgctggattctggacaacgtgccgggtgcacgcgacaaggcgcgccagggcaagctc
gcgttcggcaccgtcgacagctggctcgtgtggaacttcacgaagcacgaactgcacgtg
accgacgtgacgaacgcatcgcgcacgatgctgttcaacatccatacgcgcgaatgggac
agcgagctgctcgaactgctcgacatcccgcgcagcatgctgccggaagtgaaggcatcg
tcggaaatctacggccacaccaagaccaccgtgttcgcgtcgaagatcccgctcgcgggc
atcgccggcgaccagcacgcggcgctgttcggccagatgtgcacgacgtcgggcatggtg
aagaacacctacggcaccggctgcttcctgatgatgaacaccggcgacaagccgatcgaa
tcgaagaacaacctcgtcacgacgatcgcctggcagatcggcgatgacgtgcagtacgcg
ctcgaaggcagcatcttcatcgcgggcgcggtcgtgcagtggctgcgcgacggcgtcggc
ctcatcaagacggccgcggaaatcgaggcgctcgccgcgagcgtgccgcacaccgacggc
gtgtatctcgtgcccgcgttcgccggtctcggcgcgccgcactggaacgcgcgggcgcgc
ggctcggtgttcggcgtcacgcgcggtacgagcgccgcgcatctcgcgcgcgcggcgctc
gatgcgatcgcgtatcagtcgctcgacgtgctggccgcgatggaagccgattcgggtatc
agcatcggcgagttgcgcgtcgatggcggcgccagcgcgaacgacctgctgatgcagttc
caggccgacctgctcggcgtcgacgcggtgcgtccgcagatcaccgagacgaccgcgctc
ggcgcggcctacctcgcgggtctcgcgatcggctactggaagaacctcgacgaagtgcgc
gaccagtggcagctcgatcgccgcttcgcaccgtcgatgccgaaggagcaggtcgagcag
cgcatggccggctggcagcgtgcggtgcgcgccgcgaaggcatgggccgacgacacccag
taa

DBGET integrated database retrieval system