KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2798Help
Entry
Bcen2424_2798     CDS       T00415                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bch03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3094307..3095134)
Genome map
AA seq 275 aa AA seqDB search
MPELPEVEVTRRGIEPFVAGRRVERVDVRTAMLRWPVPAGLAEQLRAREVLAVERRGKYL
LFEVDAGWFIVHLGMTGTLRVLPAAGVPVAAKHDHIDWIFDEFVLRFRDPRRFGAVLWHP
REAGDVHAHPLLASLGVEPFSPAFTGALLHARTRGRTVSVKQALLAGDMVVGVGNIYASE
SLFRAGIRPTTAAGKVSLPRYERLADAVRATLADAIERGGSTLRDFVGSNGESGYFQLDC
FVYDRAGQPCRVCGTPVRQIVQGQRSTYFCPTCQR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttgccagaagtcgaagtcacgcgccggggcatcgagccctttgtcgcgggc
cgccgcgtcgagcgtgtcgacgtccgtaccgcgatgctgcgctggcccgtgccggcgggg
ctcgccgagcagttgcgcgcgcgcgaggtgctcgccgtcgagcgccgcggcaagtacctg
ctgttcgaggtcgatgcgggctggttcatcgtccatctcgggatgacgggcacgctgcgc
gtgctgcccgcggccggcgtgccggtcgccgcgaagcacgaccacatcgactggatcttc
gacgaattcgtgctgcgcttccgcgatccgcgccgcttcggcgccgtgctgtggcacccg
cgcgaagcaggcgacgtgcatgcgcatccgctcctcgcgagcctcggcgtcgagccgttc
tcgccggcattcaccggcgcgctgctgcatgcgcgcacgcgcggccgcacggtgtcggtc
aagcaggcgctgctcgcgggcgacatggtcgtcggtgtcggcaacatctatgcgtcggag
agcctgtttcgcgccggcatccggccgacgacggccgccggcaaggtttcgctgccgcgc
tacgagcggctggccgacgcggtgcgcgcgacgctcgccgacgcgatcgagcgcggcggc
agcacattgcgcgatttcgtcggcagcaacggcgaaagcggctacttccagctcgactgc
ttcgtctacgatcgtgccggccagccgtgccgcgtttgcggcacgccggttcgccagatc
gtgcagggtcagcggtcgacctatttctgcccgacgtgccagcgttga

DBGET integrated database retrieval system