KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2857Help
Entry
Bcen2424_2857     CDS       T00415                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcen2424_2857 (gpmA)
   01230 Biosynthesis of amino acids
    Bcen2424_2857 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_2857 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Bcen2424_2857 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcen2424_2857 (gpmA)
Enzymes [BR:bch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcen2424_2857 (gpmA)
Exosome [BR:bch04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcen2424_2857 (gpmA)
  Exosomal proteins of melanoma cells
   Bcen2424_2857 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3155015..3155827
Genome map
AA seq 270 aa AA seqDB search
MSGPGSVPCGAPRFPSLPTARSMYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQ
AGELLKEAGYTFDIAYTSVLKRAIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNK
AETAAKFGDEQVLVWRRSYDTPPPALEPTDERAPFNDPRYAKVPREQLPLTECLKDTVAR
VLPLWNESIAPAVRAGKQVLIAAHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDE
NLKPIKHYYLGDQDAIAQAQAAVAKQGKAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccccggttcggtcccgtgcggcgcgccccgcttcccatcactaccgaccgca
agatccatgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaac
cgcttcaccggctgggtcgacgtcgacctgaccgaacagggtcgcaacgaggcctaccag
gccggcgaactgctcaaggaggccggctacacgttcgacatcgcgtacacgtcggtgctc
aagcgcgcgatccgcacgctgtggcacgtgcaggacaagatggacctgatgtacctgccg
gtcgtccactcgtggcgcctgaacgagcgccactacggcgcgctgtcgggcctgaacaag
gcggaaacggccgcgaagttcggcgacgagcaggtgctcgtgtggcgccgcagctacgac
acaccgccgcccgcgctcgagccgaccgacgagcgcgcgccgttcaacgacccgcgctac
gcgaaggtgccgcgcgagcaactgccgctcaccgagtgcctgaaggacacggtcgcgcgc
gtgctgccgctgtggaacgagtcgatcgcgccggcggtgcgcgccggcaagcaggtgctg
atcgccgcgcacggcaactcgctgcgcgcgctgatcaagtacctcgacggcatctcggac
agcgacatcgtcggcctgaacatcccgaacggcgtgccgctcgtgtatgagctcgacgag
aacctgaagccgatcaagcactattacctcggcgaccaggacgcgatcgcgcaggcgcag
gccgccgtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system