KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2911Help
Entry
Bcen2424_2911     CDS       T00415                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00071  Fatty acid degradation
bch00280  Valine, leucine and isoleucine degradation
bch00281  Geraniol degradation
bch00310  Lysine degradation
bch00360  Phenylalanine metabolism
bch00362  Benzoate degradation
bch00380  Tryptophan metabolism
bch00410  beta-Alanine metabolism
bch00627  Aminobenzoate degradation
bch00640  Propanoate metabolism
bch00650  Butanoate metabolism
bch00903  Limonene and pinene degradation
bch00930  Caprolactam degradation
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01212  Fatty acid metabolism
Module
bch_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcen2424_2911
   00650 Butanoate metabolism
    Bcen2424_2911
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen2424_2911
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcen2424_2911
   00310 Lysine degradation
    Bcen2424_2911
   00360 Phenylalanine metabolism
    Bcen2424_2911
   00380 Tryptophan metabolism
    Bcen2424_2911
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcen2424_2911
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcen2424_2911
   00281 Geraniol degradation
    Bcen2424_2911
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen2424_2911
   00627 Aminobenzoate degradation
    Bcen2424_2911
   00930 Caprolactam degradation
    Bcen2424_2911
Enzymes [BR:bch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bcen2424_2911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 TAF
Motif
Other DBs
NCBI-ProteinID: ABK09659
JGI: Bcen24242911
Position
1:complement(3215231..3216058)
Genome map
AA seq 275 aa AA seqDB search
MADLAAYGGYEALKVTRRDHGVLDIVMSGEGANRSGLATANARMHRELADIWRDVDRDPD
TRVAVIRGEGKGFSAGGDLALVEEMANDFDVRARVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADISIAAKDARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYLMLCEP
VSGEEAERIGLVSLAVEPADLLPKAYEVAERLAHGSQSAIRWTKYALNNWLRMAGPTFDT
SLALEFMGFSGPDVQEGIRSLRERRPPAFPGDAPF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcttgccgcgtacggcggttacgaagcactgaaggtgacgcgccgcgaccat
ggcgtgctcgacatcgtgatgagcggcgagggcgcgaaccgcagcggcctcgcgaccgcg
aacgcgcgcatgcatcgcgagctcgccgacatctggcgcgacgtcgatcgcgatcccgac
acgcgcgtcgcggtgatccgcggcgaaggcaagggcttttcggcgggcggcgatctcgcg
ctcgtcgaggagatggcgaacgatttcgacgtgcgcgcccgcgtgtggcgcgaggcgcgt
gacctcgtctacaacgtaatcaactgcagcaagccgatcgtgtcggcgatgcacggcccg
gccgtcggcgcagggctcgtcgccgggctgctcgccgacatctcgatcgccgcgaaggat
gcgcgcatcatcgacggccatacgcggctcggcgtcgcggccggcgaccacgcggcgatc
gtgtggccgctcctgtgcgggatggcgaaggcgaagtactacctgatgctgtgcgagccc
gtgagcggcgaggaggccgagcggatcgggctggtctcgctcgcggtcgagccggccgac
ctgctgccgaaggcatacgaagtggccgagcggctcgcgcacggttcgcagtcggcgatc
cgctggaccaagtacgcgctgaacaactggctgcgcatggccggcccgaccttcgatacg
tcgctcgcgctcgaattcatgggtttttcggggcccgacgtgcaggaaggcatccgttcg
ctgcgcgagcggcgcccgcccgcgttccccggcgacgcgccgttctga

DBGET integrated database retrieval system