KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3424Help
Entry
Bcen2424_3424     CDS       T00415                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcen2424_3424
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_3424
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen2424_3424
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcen2424_3424
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcen2424_3424
   00626 Naphthalene degradation
    Bcen2424_3424
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcen2424_3424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(253843..254922)
Genome map
AA seq 359 aa AA seqDB search
MKAAILKSLGQPLAIETIPDPVLGTGEVVVDVVATPVLSYAREVFSGERRYPIELPMVPG
CGAIGRVRQTGPDATQLQPGDWVFCDPTVRSRDDARMPDIVLQGWSARGEGGKQLQRYFH
DGPFAERLRVPTENAVRIGAIAPADAARWCALNTLLVPYGGLLASDLRAGEILLVSGATG
NFGSACIAVALAMGAQCVVAPGRNARVLAELERRFGERVRTVGLTGDETADRIRMQQAAP
GPIDCVIDLMPPSVPATTVRAAVMAVRPYGRVVLMGGVGMLGGAGLELPYPWIMRNDITL
RGKWMYPTEAVTLMTGLVRGGLLDLGHFDVTVFALDDANDAVAHAAEHGGPFRMTVIAP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgatcctgaagtcgctcggccagccgctcgcgatcgaaacgataccggac
cccgtgctcggcaccggcgaagtcgtcgtggacgtcgtcgcgacgccggttctgtcctat
gcacgggaagtgttcagcggcgagcgccgctatccgatcgagttgccgatggtgccgggc
tgcggcgcgatcggccgggtccggcaaaccggccccgacgcgacgcaattgcagccgggc
gactgggtgttctgcgacccgaccgtgcgctcgcgcgacgatgcgcggatgcccgacatc
gtgctgcagggctggagtgcgcgcggcgaaggcggcaagcagttgcagcgctatttccac
gacggcccgttcgccgagcggctgcgcgtgccgaccgagaacgcggtgcgcatcggcgcg
atcgcgccggccgacgccgcgcgctggtgcgcactcaatacgctgctcgtgccttacggc
ggcctgcttgcgtccgacctgcgcgccggcgaaatcctgctcgtcagcggcgcgaccggc
aatttcggcagcgcctgcatcgcggtggcgctggcgatgggcgcgcaatgcgtggtcgcg
cccggccgtaatgcacgcgtgctggcggagctcgaacgccgcttcggcgagcgcgtgcgc
acggtcgggctgaccggcgacgaaaccgcggaccgcatccgcatgcagcaggcggcgccg
gggccgatcgactgcgtgatcgacctgatgccgccgtcggtgccggcgacgacggtgcgt
gccgccgtgatggccgtgcgtccttatggacgcgtggtgctgatgggcggcgtcggcatg
ctcggcggagccgggctcgagctgccgtatccgtggatcatgcgcaacgacatcacgctg
cgcggcaaatggatgtacccgacggaagccgtgacgctgatgaccgggctcgtccgcggc
gggttgctcgacctcgggcatttcgacgtaacggtcttcgcgctcgacgacgcgaacgac
gcggtcgcgcatgcggcggaacatggcgggccgttcaggatgacggtgatcgcgccgtag

DBGET integrated database retrieval system