KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3792Help
Entry
Bcen2424_3792     CDS       T00415                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K13491  two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch02020  Two-component system
Module
bch_M00509  WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcen2424_3792
Enzymes [BR:bch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bcen2424_3792
Two-component system [BR:bch02022]
 CheA family
  WspE-WspRF [MD:M00509]
   Bcen2424_3792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABK10529
JGI: Bcen24243792
Position
2:653125..654144
Genome map
AA seq 339 aa AA seqDB search
MNIGIVNDLPLAVEALRRVIALRADHRVLWVATDGDEAVDFCVAHPPDVVLMDLVMPKVD
GVAATRRIMARAPCAILIVTASVSANTSSVYEAMGAGALDAVDTPTLALGLSTDASPQAL
LAKIDQIGRLLESRTTALVPPGPAPTRGQPTLVAIGASAGGPTALTALLRALPADFPAAI
VIVQHVDQAFAYGMAEWLDGYTRLPVRVARQGSVPEAGAVLLAATNDHLMLSPRGVLGYT
RHPAETPYRPSIDVFFNSVADGWQGDALGVLLTGMGRDGALGLKAMRAKGCYTIAQDQAT
SAVYGMPKAAAAIGAASAILPLDQIAPQLIARIALTSRD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggtatcgtcaatgatctgccgctggccgtggaggcactgcgccgcgtgatc
gcgctgcgcgcggatcatcgcgtgctgtgggtcgcgaccgatggcgacgaggcggtggat
ttctgcgtcgcgcatccgcccgacgtcgtgctgatggacctcgtgatgccgaaggtcgat
ggcgtcgccgcgacgcgccggatcatggcacgcgcgccgtgcgcgatcctgatcgtgacg
gcgagcgtcagcgcgaacacgtcgtcggtgtacgaggcgatgggcgccggcgcgctcgac
gcggtcgacacgccgacgctcgcgctcgggctgtcgaccgacgcatcgccgcaggcgctg
ctcgcgaagatcgaccagatcggccggctgctcgaaagccgcaccacggcgcttgtgcca
ccggggccggcccccacgcgcggacagccgacgctcgtcgcgatcggtgcgtcggcgggc
ggcccgaccgcgctcaccgcgctgctgcgcgcgctgccggccgattttccggcggcgatc
gtgatcgtccagcacgtcgaccaggcattcgcgtacggcatggccgaatggctcgacggc
tatacgcggctgccggtgcgcgtcgcgcggcagggcagcgtgcccgaggccggtgcggtg
ctgctcgcggcgaccaacgaccatctgatgctgtcgccgcgcggcgtgctcggctatacg
cggcatccggccgaaacgccgtaccggccgtcgatcgacgtgttcttcaacagcgtcgcg
gacggctggcagggcgatgcgctcggcgtgctgctgaccggcatgggacgcgacggcgcg
ctcggcctgaaggcgatgcgggcgaagggctgctacacgatcgcgcaggaccaggcgacc
agcgccgtgtacgggatgccgaaggccgcggcggcgatcggcgcggcgtcggcgatcctg
ccgctcgaccagatcgcgccccagttgatcgcgcggatcgcactgacatcgcgcgactga

DBGET integrated database retrieval system