KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3960Help
Entry
Bcen2424_3960     CDS       T00415                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcen2424_3960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcen2424_3960
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcen2424_3960
Enzymes [BR:bch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcen2424_3960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:841324..842139
Genome map
AA seq 271 aa AA seqDB search
MNRIKQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQRSSERALARGVTLKSVLADVKRFRETDPKTPVVLMGYANPIERMGVDAFAAEAHA
AGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDERIADVGKIASGYVYYVSLK
GVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQLL
ESAAPEGAAAALKTFIAELRAALDGAGNTAR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtattaagcagaccttcgccgcgctcgccgaacaaggccgtaagggcctgatc
ccgttcatcacggccggcgaccctgatcccgcgaaaaccgtcgaattcatgcacgcgctc
gccgccggcggcgcggacgtgatcgaactcggcgtgccgttctcggacccgatggccgac
ggccccgtgatccagcgctcgtcggaacgcgcgctcgcgcgcggcgtcacgttgaagagc
gtgctcgccgacgtgaagcgttttcgcgaaaccgaccccaaaacccccgtcgtgctgatg
ggctatgcgaacccgatcgaacggatgggcgtcgacgcattcgcggccgaagcccacgcg
gccggcgtcgacggcgtgctggtggtcgactatccgccggaagaggcgggcgtattcgcc
gagaaaatgcgtgccgcgcagatcgatccgatcttcctgctcgcgcccacgtcgaccgac
gaacgcatcgccgacgtcggcaagatcgcgagcggctacgtgtattacgtgtcgctcaag
ggcgtgaccggcgcgggaaatctggatgtttcgagcattgcaggtaaaatcccggccatc
aagtcgcgcgtgccggttccggtgggcgtcggcttcggtatccgcgacgccgaaacggcg
cgcgcggtggccgaagtgtcggacgccgtcgtgatcggcagccgcctcgtgcagctgctc
gagagcgccgcgccggaaggtgccgccgccgcgttgaagactttcatcgccgagctgcgt
gctgcgctggacggtgcgggcaacacggcgcgataa

DBGET integrated database retrieval system