KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3977Help
Entry
Bcen2424_3977     CDS       T00415                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00040  Pentose and glucuronate interconversions
bch00052  Galactose metabolism
bch00500  Starch and sucrose metabolism
bch00520  Amino sugar and nucleotide sugar metabolism
bch01100  Metabolic pathways
bch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcen2424_3977
   00052 Galactose metabolism
    Bcen2424_3977
   00500 Starch and sucrose metabolism
    Bcen2424_3977
   00520 Amino sugar and nucleotide sugar metabolism
    Bcen2424_3977
Enzymes [BR:bch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcen2424_3977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABK10714
JGI: Bcen24243977
Position
2:862706..863593
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGREWE
EDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLA
NEQVLAYRYYGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggccgtgttccccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgttgcccgtcgtcgacaagccgctgatccagtac
gcggtcgaggaagcgatcaacgccggtatcaccgagatgatcttcgtcaccgggcgcagc
aagcgcgcgatcgaggatcatttcgacaagtcgtacgagatcgaggccgagctcgaggcg
cgcggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagccacgtcaactgc
ttctacgtgcgccagccggaagcgctcggcctcggccacgcggtgctgtgcgcggagaag
ctcgtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcacggcgaacag
ccggtgctcaagcagctcgtcgacgtgttcgaccactatcacagctcggtgatcggggtc
gagacgatcccgcgcgaggacagccgctcgtacggcgtcgtcgaaggccgggaatgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgccggaggatgcgccgtcg
aacctcggcgtggtcggccgctacgtgttcatgccgacgatcttcgatcacctgcgcaag
ctcaagccgggcgcgggcggcgaactgcagctcaccgacgccgtccagtcgctgctcgcg
aacgaacaggtgctcgcgtatcgctactacggcacgcgtttcgactgcggcagcaagatc
ggctatctgaaggccaccgtcgagctcgcgctccagcatccggaagtgagccgcgaattc
gaggcgtacctgcgtacctgcttgcccgcgctggctgccgtcgcttaa

DBGET integrated database retrieval system