KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3977Help
Entry
Bcen2424_3977     CDS       T00415                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcen2424_3977
   00052 Galactose metabolism
    Bcen2424_3977
   00500 Starch and sucrose metabolism
    Bcen2424_3977
   00520 Amino sugar and nucleotide sugar metabolism
    Bcen2424_3977
Enzymes [BR:bch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcen2424_3977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:862706..863593
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGREWE
EDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLA
NEQVLAYRYYGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggccgtgttccccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgttgcccgtcgtcgacaagccgctgatccagtac
gcggtcgaggaagcgatcaacgccggtatcaccgagatgatcttcgtcaccgggcgcagc
aagcgcgcgatcgaggatcatttcgacaagtcgtacgagatcgaggccgagctcgaggcg
cgcggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagccacgtcaactgc
ttctacgtgcgccagccggaagcgctcggcctcggccacgcggtgctgtgcgcggagaag
ctcgtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcacggcgaacag
ccggtgctcaagcagctcgtcgacgtgttcgaccactatcacagctcggtgatcggggtc
gagacgatcccgcgcgaggacagccgctcgtacggcgtcgtcgaaggccgggaatgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgccggaggatgcgccgtcg
aacctcggcgtggtcggccgctacgtgttcatgccgacgatcttcgatcacctgcgcaag
ctcaagccgggcgcgggcggcgaactgcagctcaccgacgccgtccagtcgctgctcgcg
aacgaacaggtgctcgcgtatcgctactacggcacgcgtttcgactgcggcagcaagatc
ggctatctgaaggccaccgtcgagctcgcgctccagcatccggaagtgagccgcgaattc
gaggcgtacctgcgtacctgcttgcccgcgctggctgccgtcgcttaa

DBGET integrated database retrieval system