KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4006Help
Entry
Bcen2424_4006     CDS       T00415                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00010  Glycolysis / Gluconeogenesis
bch00071  Fatty acid degradation
bch00350  Tyrosine metabolism
bch00625  Chloroalkane and chloroalkene degradation
bch00626  Naphthalene degradation
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_4006
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen2424_4006
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcen2424_4006
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcen2424_4006
   00626 Naphthalene degradation
    Bcen2424_4006
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcen2424_4006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABK10742
JGI: Bcen24244006
Position
2:893471..894628
Genome map
AA seq 385 aa AA seqDB search
MNPFQFRTVPTQIVEFGAARRLGALLRERFPALVRLCVVTDAFLHRSGVLAPALESLAAH
GWQVTVIDDVIADPPEHVVLEATARAVAADAEIVLGLGGGSSMDVAKLIAVLAPGQQALA
DMYGVDKVASARLPLVQMPTTAGTGSEVTAVSIVTVGEARKMGVVSPHLFADVAILDAEL
TLGLPRAATAATGIDAMVHAIEAYTSARLKNPVSDMLATHALTLLSRNLLPACDDGRNRH
AREAMLVGAMFAGQAFANAPVAAVHALAYPVGGIFHVPHGLSNALVLPHVLRFNAPAAAP
LYAELAAIAAPSATGSDEAKTHALIAEIDRLIVATGIPRTLREVGIGEADLPRMASDAML
QTRLLVNNPREVTEADALEIYRQAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtttcaattccgtaccgttccgacccagatcgtcgaattcggcgccgcgcgc
cggctcggcgcgctgttgcgcgaacgctttccggcgctcgtgcggctgtgcgtcgtcacc
gatgcgttcctgcatcgcagcggcgtgctcgcgcccgcgctggagagcctcgccgcgcat
ggctggcaggtcaccgtgatcgacgacgtgatcgccgatccgcccgagcacgtggtgctc
gaagccaccgcgcgggccgtcgcggccgatgccgagatcgtgctcgggctcggcggcggc
tcgtcgatggacgtcgcgaagctgatcgcggtgctcgcgccggggcagcaggcgctggcc
gacatgtacggcgtcgacaaggtcgcgagcgcgcggctgccgctcgtgcagatgccgacc
acggccggcacgggctccgaggtcacggccgtgtcgatcgtcacggtcggcgaggcgcgc
aagatgggggtcgtgtcgccgcatctgttcgcggacgtcgcgatcctcgacgcggaactc
acgctcggcctgccgcgcgcggcgacggccgccaccggcatcgacgcgatggtgcatgcg
atcgaggcgtacacgtccgcgcggctgaagaatccggtgtccgacatgctggccacgcac
gcgctgacgctgctgtcgcgcaacctgctgcccgcctgcgacgacggccggaaccggcac
gcgcgcgaagcgatgctggtcggcgcgatgttcgcggggcaggcgttcgcgaatgcgccg
gtcgcggccgtgcacgcgctggcttatcccgtgggcgggatcttccatgtgccgcacggg
ctgtcgaatgcgctggtgctgccgcacgtgctgcgcttcaatgcgccggccgccgcgccg
ctgtatgcggaactggcggccatcgccgcgccgtcggccacgggcagcgacgaagcgaaa
acgcacgcgctgatcgccgagatcgaccggctgatcgtcgcgacgggcattccgcgcacg
ttgcgggaggtcggtatcggcgaggccgacctgccgaggatggcgtcggacgcaatgctg
cagacgcgcctgctcgtgaacaatccgcgcgaggtgaccgaggccgacgcgctggagatt
taccggcaggcgtggtga

DBGET integrated database retrieval system