KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4056Help
Entry
Bcen2424_4056     CDS       T00415                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcen2424_4056
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bcen2424_4056
Enzymes [BR:bch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bcen2424_4056
Two-component system [BR:bch02022]
 CheA family
  CheA-CheYBV
   Bcen2424_4056
Bacterial motility proteins [BR:bch02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bcen2424_4056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(950541..951545)
Genome map
AA seq 334 aa AA seqDB search
MNIGIVNDLPLAVEAMRRAIARRPEHRVLWVATDGPQAVELCAAQPPDIVLMDLIMPKFD
GIEATRRIMRSERPCAILIVTSCIGANAWRVFEAMGAGALDAVDTPRLGDGAAGDTTKLL
LAKIDQIGRLLDAPGSSRLAGAAARGGAGPLIAIGASAGGPGALASILGNLPADFNAPIV
IVQHVDRAFAEGMAQWLDGQTRLAVRVAREGDRPQPGVALLAATDDHLRITRAGTLEYTR
EPAATPYRPSVDVFFNSLTEHWPGRVIGVLLTGMGRDGAIGLKALRMKGYHTIAQDEATS
AVYGMPKAAATLGAARAILPLGRIAGELAALARI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcggcatcgtcaacgacctcccgcttgccgtcgaggcgatgcgccgcgcgatc
gcgcgacggcccgagcaccgcgtgctgtgggtcgcgaccgacggcccgcaggccgtcgaa
ctgtgcgccgcgcagccgcccgacatcgtgctgatggatctgatcatgccgaaattcgac
gggatcgaggcgacgcgtcggatcatgcgctccgaacgaccgtgcgcgatcctgatcgtg
acgagctgcatcggcgcgaacgcgtggcgcgtgttcgaggcgatgggcgccggcgcgctc
gacgcggtcgacacgccgcggctcggcgacggcgcggccggcgacacgacgaaactgctg
ctcgcgaagatcgaccagatcggccgcctgctcgacgcaccgggcagctcgcgcctcgcc
ggtgcggccgcgcgcggcggcgccggcccgctgatcgcgatcggcgcatcggccggcggc
cccggcgcgctcgcgtcgatcctcggcaacctgccggccgatttcaatgcgccgatcgtg
atcgtgcagcacgtcgatcgcgcgttcgccgaaggcatggcgcaatggctcgacggccag
acccggctcgccgtgcgcgtcgcgcgcgaaggcgaccgcccacagccgggcgtcgcgctg
ctcgccgcgaccgacgatcacctgcgcatcacgcgcgccggcacgctcgaatacacgcgg
gagccggccgccacgccgtatcgcccgtcggtcgacgtattcttcaacagcctgaccgag
cactggccgggccgcgtgatcggcgtgctgctcacggggatgggccgcgacggcgcgatc
ggcctgaaggcgctgcggatgaagggctaccatacgatcgcgcaggacgaggcgaccagc
gccgtgtacgggatgccgaaggcggccgcgacgctcggcgcggcgcgggcgatcctgccg
ctcgggcgcatcgcgggcgaactggcggcgctggcgcgaatctga

DBGET integrated database retrieval system