KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4940Help
Entry
Bcen2424_4940     CDS       T00415                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00220  Arginine biosynthesis
bch00250  Alanine, aspartate and glutamate metabolism
bch00471  D-Glutamine and D-glutamate metabolism
bch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcen2424_4940
   00220 Arginine biosynthesis
    Bcen2424_4940
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bcen2424_4940
Enzymes [BR:bch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Bcen2424_4940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ABK11674
JGI: Bcen24244940
Position
2:1946803..1947717
Genome map
AA seq 304 aa AA seqDB search
MNYQSILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTLDGNVYTVGDAYERFS
IQSISKLFACTLAFQLLGDELWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVKAETALVEFVRRLIGSNDIDYDSRVALSELQHAERNRAMAHFMASFGNMQMP
PDTVIDAYCRQCAIEMNCVELATAALFLANGGIAPATGERVVDSSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDANGNSLAGTLALEWLTTYTE
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaatcgattcttgaacgcatccacaccgaactcgccccctggatcggccag
ggacgggtggccgactatattcccgagctcgcgaaagtgcccgccgacaagttcgggatg
gccgtcgtgacgctcgacggaaacgtttacacggtcggcgatgcgtacgagcgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagctgctcggcgacgag
ctgtgggaacgggtcggccgcgagccgtccggcaccgcgttcaactcgctggtccagctc
gaaagcgagcgcggcaagccgcgcaatccgttcatcaatgcgggcgcgctggtggtcacc
gacgtgctgtgccgccgcttcgtgaaggccgagacggcgctcgtcgaattcgtgcggcgg
ctgatcggctcgaacgacatcgactacgactcgcgcgtcgcgttgtcggagttgcagcac
gcggaacgcaaccgcgcgatggcgcatttcatggcgagcttcggcaacatgcagatgccg
cccgatacggtgatcgacgcgtattgccgccagtgtgcgatcgagatgaactgcgtcgag
cttgccaccgcggcgctgttcctcgcgaatggcggtatcgcgccggcgaccggcgaacgg
gtcgtcgattcgagttcggcgaagcggctgtcggcgctgatgttgacctgcgggacgtac
gatgcggcgggcgatttcgtgtatcgcgtcgggttgccggcgaaaagcggcgtcggcggc
gggatcgtcgcggtgctgcccggggagatggccgtgtgcgtgtgggcgccagggctggat
gcgaacgggaactcgctggcggggacattggcgctggagtggttgacgacttatacggag
cggtcgattttttga

DBGET integrated database retrieval system