KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4940Help
Entry
Bcen2424_4940     CDS       T00415                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcen2424_4940
   00330 Arginine and proline metabolism
    Bcen2424_4940
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bcen2424_4940
Enzymes [BR:bch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Bcen2424_4940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1946803..1947717
Genome map
AA seq 304 aa AA seqDB search
MNYQSILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTLDGNVYTVGDAYERFS
IQSISKLFACTLAFQLLGDELWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVKAETALVEFVRRLIGSNDIDYDSRVALSELQHAERNRAMAHFMASFGNMQMP
PDTVIDAYCRQCAIEMNCVELATAALFLANGGIAPATGERVVDSSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDANGNSLAGTLALEWLTTYTE
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaatcgattcttgaacgcatccacaccgaactcgccccctggatcggccag
ggacgggtggccgactatattcccgagctcgcgaaagtgcccgccgacaagttcgggatg
gccgtcgtgacgctcgacggaaacgtttacacggtcggcgatgcgtacgagcgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagctgctcggcgacgag
ctgtgggaacgggtcggccgcgagccgtccggcaccgcgttcaactcgctggtccagctc
gaaagcgagcgcggcaagccgcgcaatccgttcatcaatgcgggcgcgctggtggtcacc
gacgtgctgtgccgccgcttcgtgaaggccgagacggcgctcgtcgaattcgtgcggcgg
ctgatcggctcgaacgacatcgactacgactcgcgcgtcgcgttgtcggagttgcagcac
gcggaacgcaaccgcgcgatggcgcatttcatggcgagcttcggcaacatgcagatgccg
cccgatacggtgatcgacgcgtattgccgccagtgtgcgatcgagatgaactgcgtcgag
cttgccaccgcggcgctgttcctcgcgaatggcggtatcgcgccggcgaccggcgaacgg
gtcgtcgattcgagttcggcgaagcggctgtcggcgctgatgttgacctgcgggacgtac
gatgcggcgggcgatttcgtgtatcgcgtcgggttgccggcgaaaagcggcgtcggcggc
gggatcgtcgcggtgctgcccggggagatggccgtgtgcgtgtgggcgccagggctggat
gcgaacgggaactcgctggcggggacattggcgctggagtggttgacgacttatacggag
cggtcgattttttga

DBGET integrated database retrieval system