KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4962Help
Entry
Bcen2424_4962     CDS       T00415                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00010  Glycolysis / Gluconeogenesis
bch00620  Pyruvate metabolism
bch00640  Propanoate metabolism
bch00680  Methane metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen2424_4962
   00620 Pyruvate metabolism
    Bcen2424_4962
   00640 Propanoate metabolism
    Bcen2424_4962
  Energy metabolism
   00680 Methane metabolism
    Bcen2424_4962
Enzymes [BR:bch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcen2424_4962
Lipid biosynthesis proteins [BR:bch01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcen2424_4962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABK11696
JGI: Bcen24244962
Position
2:complement(1970275..1971981)
Genome map
AA seq 568 aa AA seqDB search
MTVQAFLDARDFLLRHRTDYDTAYRDFAWPVLDAFNWALDYFDPMARGNDQPALWIVDAA
TGTGDPYSFAQMSERSSRIANWLRSIGVGRGDRILLMLPNRVELWDAMLAAMKLGAIVLP
ATTQLSPDDVRDRVQIGGATYAIVDEHETAKFEQAGLGLKQKIVAGVPREGWLAMNDGYA
ASAAFEPDAVTHANDPMLLYFTSGTTSKPKLVEHTHRTYPIGHLSTMYWVGLQPGDIHWN
ISSPGWAKHAWSCFFAPWNAQACVFAFNYARFEPKVVLDALVKYRVTTLCAPPTVWRMLV
QQPLASFDVKLREIVGAGEPLNPEIIERVKKAWNISIRDGYGQTETTCLIGNSPGQPVVA
GSMGRPLPGYRIALLDPDGAPVTEGEVALPIGDDVTRPVGLMKGYANNPDATAHAMRDGH
YRTSDIAMRRDDGYYVYIGRADDVFKSSDYRLSPFELESVLIEHPAIAEAAVVPSPDPVR
LSVPKTFITLRQGYEESPALALEIFRFSREKLAPYKRIRRLQFAELPKTISGKIRRVELR
RREIERGDDATERMPGEYWEEDFANELK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacggtacaggcattcctggacgcacgcgacttcctgctgcgccatcgcaccgactac
gacaccgcgtatcgcgatttcgcatggccggtgctcgatgcgttcaactgggcgctcgac
tacttcgacccgatggcgcgcggcaacgaccagcccgcgctgtggatcgtcgatgcggcg
accggcacgggcgatccgtattcgttcgcgcagatgtccgagcgttcgtcgcggatcgcg
aactggttgcgttcgatcggcgtcgggcgcggcgaccgcatcctgttgatgctgccgaat
cgggtcgagttgtgggacgcgatgctggccgcgatgaagctcggcgcgatcgtgctgccc
gccaccacgcaactgtcgcccgacgacgtgcgcgaccgcgtgcagatcggcggcgcgacc
tacgcgatcgtcgacgagcacgaaaccgcgaagttcgagcaggccggcctcggcctcaag
cagaaaatcgtcgccggcgtgccgcgcgaaggctggctcgcgatgaacgacggctatgcg
gcgagcgccgcgttcgagccggacgccgtcacgcacgcgaacgatccgatgctgctgtac
ttcacgtcgggcacgacgtcgaagccgaagctcgtcgagcatacgcaccgcacctatccg
atcgggcacctgtcgacgatgtactgggtcggcctgcaaccgggcgacatccactggaac
atcagctcgccgggctgggcgaagcacgcgtggagctgcttcttcgcgccgtggaatgcg
caggcgtgcgtgttcgcgttcaactatgcgcgcttcgagccgaaggtcgtgctcgatgcg
ctcgtcaagtatcgggtgacgacgctgtgcgcgccgccgaccgtgtggcgcatgctggtg
cagcagccgctcgcgtcgttcgacgtgaagctgcgcgagatcgtcggcgcgggcgagccg
ctgaatcccgagatcatcgagcgcgtgaagaaggcctggaacatctcgattcgcgacggc
tacggccagaccgagacgacctgcctgatcggcaattcgccgggccagccggtagtcgcc
ggctcgatgggccggccgctgcccggctaccggatcgcgctgctcgacccggacggcgcg
ccggtgaccgaaggcgaggtcgcgctgccgatcggtgacgacgtcacgcgcccggtcggg
ctgatgaagggctacgcgaacaatcccgatgcgacggctcatgcgatgcgcgacggtcac
taccgtacgtcggacatcgcgatgcgtcgcgacgatggctactacgtgtacatcggccgc
gcagacgacgtgttcaagtcgtccgactatcggctgagcccattcgaactggaaagcgtg
ctgatcgagcatccggcgatcgcggaagcggccgtcgtgccgagcccggacccggtgcgg
ttgtcggtgccgaagaccttcatcacgctgcgtcagggctacgaggaaagccccgcgctc
gcgctggagatcttccgtttctcgcgcgagaagctcgcgccgtacaagcgcatccgtcgc
ctgcagttcgcggaactgccgaagacgatctcggggaagatccgccgcgtcgagctgcgc
cgccgcgagatcgagcgtggcgacgacgcgaccgagcgcatgcccggcgagtactgggaa
gaagatttcgccaacgaactgaaatga

DBGET integrated database retrieval system