KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5090Help
Entry
Bcen2424_5090     CDS       T00415                                 

Definition
alcohol dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcen2424_5090
  Energy metabolism
   00680 Methane metabolism
    Bcen2424_5090
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcen2424_5090
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Bcen2424_5090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2119930..2121126)
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGQVEVQKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKLGDLVSVPFNVACGRCAMCKDTHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHARAMGFETVDLSKD
ASLGEQIEQILGVPEIDCAVDCVGFEAHGHGSSGHSEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILFDRLPIA
KIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttgggccgggccaggtcgaagtccagaaaatc
gattatccgaagatggtcgacccaagcggccgcgcgatcggccacggcgtgatcctgaaa
gtggtcagcacgaacatctgcggctccgaccagcacatggtgcgcggccgtacgaccgcg
ccggtcggcctcgtgctcggtcacgagatcaccggcgaagtggtcgaggtgggccgcgac
gtcgagacgctgaagctcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggacacgcacaccggcgtgtgcctgaacgtgaacccgtcgcgtgcc
ggcggcgcgtacggctacgtcgacatgggcggctggatcggcggccaggccgagtacgtg
ctcgtgccgtatgccgatttcaacctgctgaaattcccggatcgcgatcaggcgatggcg
aagatccgcgacctgacctgcctgtccgacatcctgccgaccggttatcacggcgcggtg
agcgcgggcgtgaagcccggttcgacggtctatatcgcgggcgcgggcccggtcgggatg
gcggcggccgcgtcggcgcgcctgctcggcgcggccgtgacgatcgtcggcgacatgaac
gcggaacgcctcgcgcatgcgcgggcgatggggttcgagacggtcgacctgtcgaaggac
gcgtcgctcggcgagcagatcgagcagatcctcggtgtgcccgagatcgattgcgcggtc
gactgcgtcggcttcgaggcgcacggtcacggctcgtcgggccattcggaggaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcgcccggccggcgcgatcggcatcccg
ggcctgtacgtgacggacgatccgggtgcgaaggacaaggccgcgcagcacggcagcctg
agcatccgcttcggcctcggctgggcgaagtcgcattcgttcttcacgggccagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
aagatcgtcaacgtcgaagtgatctcgctcgaccaggcgccggaaggctacaagaagttc
gacggcggtgcgccgcgcaaattcgtcatcgacccgcacgggttgctggcggcgtga

DBGET integrated database retrieval system