KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5239Help
Entry
Bcen2424_5239     CDS       T00415                                 

Definition
propionyl-CoA carboxylase (EC:6.4.1.3)
Orthology
K01969  
3-methylcrotonyl-CoA carboxylase beta subunit [EC:6.4.1.4]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bch00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcen2424_5239
Enzymes [BR:bch01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     Bcen2424_5239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2307321..2308928)
Genome map
AA seq 535 aa AA seqDB search
MPIIESKLNPRSEDFRANAAALEAVVADLRVKIEQLAQGGGQAARDKHLSRGKLLPRDRI
AQLLDPGAPFLEFSQLAANGMYNDDAPGAGVITGIGRIAGRECVIVCNDATVKGGTYYPV
TVKKHVRAQEIAAENRLPCVYLVDSGGANLPNQDDVFPDRDHFGRIFFNQATMSAAGIAQ
IAVVMGSCTAGGAYVPAMSDESIIVKDQGTIFLGGPPLVKAATGEEVSAEDLGGGDVHTR
LSGVADHLAQNDAHALSIARNIVGHLAPKIAPPLALREPKPPRYDAKSLYGVIPVDTRKP
FDVREVIARIVDDSEFDEFKARFGTTLVTGFAHIWGHPVGIVANNGILFSESAVKGAHFI
ELCCQRKIPLVFLQNITGFMVGRKYENEGIARHGAKMVTAVSNAKVPKFTVIIGGSFGAG
NYGMCGRAFGPRFLWMWPNARISVMGGEQAASVLATVRRDGIEAKGGSWSAEEEDAFKQP
IRDQYERQGHPYYASARLWDDGVIDPAQTRDVLGLGLAASMNAPIDDTRFGVFRM
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcatcgaatcgaaactgaacccgcgttcggaagacttccgcgcgaatgccgcg
gcgctcgaggcggtcgtcgccgacctgcgcgtgaagatcgaacagctcgcgcagggcggc
ggccaggccgcgcgcgacaagcacctgtcgcgcggcaagctgctgccgcgcgatcgcatc
gcgcaactgctcgatccgggcgcgccgttcctcgagttctcgcaactcgcggcgaacggc
atgtacaacgacgacgcgccgggcgcgggcgtcatcaccgggatcgggcgcatcgccggc
cgcgaatgcgtgatcgtgtgcaacgacgcgacggtcaagggcggcacctactacccggtc
acagtgaagaagcacgtacgcgcgcaggaaatcgccgcggaaaaccggctgccgtgcgtg
tacctcgtcgactcgggcggcgcgaacttgccgaaccaggacgacgtgtttcccgatcgc
gaccacttcggccgcatcttcttcaaccaggcgacgatgtcggcggcggggatcgcgcag
atcgccgtcgtgatgggctcgtgcacggccggcggcgcatacgtgccggcgatgagcgac
gagtcgatcatcgtgaaggaccagggcacgattttcctcggcgggccgccgctcgtgaag
gccgcgaccggcgaggaagtgagcgccgaggatctcggcggcggcgacgtgcatacgcgc
ctgtcgggcgtggccgaccatctcgcgcagaacgacgcgcatgcgctgtcgatcgcgcgc
aacatcgtcggtcacctcgcgccgaagatcgcgccgccgctcgcgctgcgcgagccgaag
ccgccgcgctacgacgcgaagagcctgtacggcgtgattccggtcgatacgcgcaagccg
ttcgacgtgcgcgaggtgatcgcgcgcatcgtcgacgattcggaattcgacgaattcaag
gcgcgcttcggcacgacgctcgtcacgggcttcgcgcacatctggggccatccggtcggg
atcgtcgcgaacaacggcatcctgttctccgaatcggcggtgaagggcgcgcatttcatc
gagctgtgctgccagcgcaagatcccgctcgtattcctgcagaacatcacgggcttcatg
gtcgggcgcaagtacgagaacgaaggcatcgcgcggcatggcgcgaagatggtgacggcc
gtgtcgaacgcgaaggtgccgaagttcacggtgatcatcggcggctcgttcggcgccggc
aactacgggatgtgcggccgcgcgttcggcccgcgtttcctgtggatgtggccgaatgca
cggatctccgtgatgggcggcgagcaggccgcatcggtgctcgcgaccgtgcgtcgcgat
ggcatcgaggcgaagggcgggtcgtggtcggccgaggaagaggacgcgttcaagcagccg
attcgcgaccagtacgagcgccagggccatccgtattacgcgagcgcgcggctgtgggac
gacggcgtgatcgatcccgcgcagacgcgcgacgtgctcgggctcggcctggccgcgtcg
atgaacgcgccgatcgacgacacgcgcttcggcgtgttccgcatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system